Property Summary

NCBI Gene PubMed Count 122
PubMed Score 340.77
PubTator Score 229.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma -2.456 2.6e-03
Multiple myeloma -1.169 3.4e-02
malignant mesothelioma -2.500 1.7e-08
astrocytic glioma 1.600 1.3e-02
ependymoma 1.700 1.1e-02
oligodendroglioma 1.600 7.1e-03
psoriasis 1.100 2.2e-03
chronic lymphosyte leukemia -1.200 6.2e-03
tuberculosis 1.500 1.0e-06
pancreatic ductal adenocarcinoma liver m... 1.805 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 9.7e-03
lung cancer 1.800 5.8e-03
acute myeloid leukemia -1.100 5.4e-03
ovarian cancer -1.700 1.1e-04

Protein-protein Interaction (4)

Gene RIF (92)

PMID Text
26797130 Oxidative stress promotes PRX2 and PRX3 hyperoxidation and attenuates pro-survival signaling in aging chondrocytes.
26614766 the species with one disulfide and one hyperoxidized active site was decameric for Prx2 and dimeric for Prx3. Reduction and re-oxidation of the hyperoxidized dimer of Prx3 produced hyperoxidized monomers
26601956 Prx2 glutathionylation is a favorable reaction that can occur in cells under oxidative stress and may have a role in redox signaling. GSH/Grx1 provide an alternative mechanism to thioredoxin and thioredoxin reductase for Prx2 recycling.
26548861 Data show the protein partners of human Prx1 and Prx2 and identified three sequence motifs, or combination thereof in Prxs partners, namely: CXXC, PXXP, and LXXLL. that can be important for protein localization, function and biological pathways. [review]
26021759 Prx II has an important role in cancer cell survival via the modulation of signaling molecules involved in apoptosis and the phosphorylation of JNK by the downregulation of reactive oxygen species levels in A549/GR cells.
25786472 Functional roles of catalase, PRDX2 and GPX1 during oxidative stress in human erythrocytes.
25471788 Further conclusion showed that Prdx2 regulates VM formation by targeting VEGFR2 activation, which now represents as a therapeutic target for RC.
25323516 two placental proteins, Prx3 and Prx4, may act as new placental immune targets.
25264713 Prx-2 activity is compromised during red blood cell storage.
25221425 Reported increased expression of ALDH3A1, PDIA3, and PRDX2 in pterygia using a proteomic approach. These proteins are presumed to have a protective role against oxidative stress-induced apoptosis.
25097261 findings suggest a model in which the release of PRDX2 and TRX from macrophages can modify the redox status of cell surface receptors and enable induction of inflammatory responses
24952139 the main role of Prx2 in human erythrocytes is not to eliminate peroxide substrates.
24909612 Taken together, cloned porcine kidney is more susceptible in JNK-induced apoptosis caused by PrxII phosphorylation, in oxidative stress condition
24862795 Results suggest that PRDX2 may perform an important function in the pathogeneis of RCMD.
24814289 Our work is the first to show that nuclear levels of PRDX2 display circadian oscillation participating in the regulation of human keratinocytes redox balance.
24750185 the reduced expression of iNOS or peroxiredoxin 2 may play an important role in the carcinogenesis of gastric cancer
24719319 In this work we characterize Prx2 tyrosine nitration, a post-translational modification on a noncatalytic residue that increases its peroxidase activity and its resistance to overoxidation.
24636884 Impaired antioxidant activity of Prx2 could contribute to the hemolysis.
24631653 These findings suggest that the transduced PEP-1-PRX2 has neuroprotective functions against oxidative stress-induced cell death in vitro and in vivo
24631019 Proteomic data suggest a limited protein set is involved in SET- (template activating factor-I-) mediated cytotoxicity of TCE (trichloroethylene) in hepatocytes; this set includes CFL1 (cofilin 1), PRDX2 (peroxiredoxin 2), and S100-A11 (calgizzarin).
24234423 Prdx2 has an essential role in regulating oxidation-induced apoptosis in colorectal cancer cells.
24222118 Up-regulation of peroxiredoxin-2 is associated with gemcitabine resistance in pancreatic cancer.
24152995 cellular distribution of Peroxiredoxin I and II in human eyes
24003226 Data indicate that engineered Prx2 and Prx3 variants C-terminal residues modulate the extent of hyperoxidation.
23749642 our findings reveal that Prx2 is a key regulator of invasion and metastasis in melanoma
23713588 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23603832 Data show peroxiredoxin 2 (Prx2) oxidation was detected at erythrocyte:neutrophil ratios found in blood and reversed over time as the oxidative burst subsided.
23499777 Real-time PCR, western blot and immunohistochemistry showed that peroxiredoxin 2 was increased in pterygium compared to healthy conjunctiva.
23429506 PRX2 battles poly(ADP-ribose) polymerase 1- and p53-dependent prodeath pathways after ischemic injury
23393224 Our data showed that the elevated AZGP1 and decreased PEDF and PRDX2 expressions in CRC serum and tissues were correlated with liver metastases.
23123411 It documents that the antioxidant protein peroxiredoxin-2 (PRDX2), the third most abundant cytoplasmic protein in RBCs, interacts with the cytoplasmic domain of B3.
23113308 Drug resistance formation was accompanied by a significant increase in the expression of PRDX1, PRDX2, PRDX3, PRDX6 genes in all cancer cell strains, which confirms the importance of redox-dependent mechanisms into development of cisplatin resistance.
22960070 These findings suggest that Prx II plays an important role in preventing hemolytic anemia from oxidative stress by binding to Hb as a decameric structure to stabilize it.
22944692 Positional proteomics analysis identifies the cleavage of human peroxiredoxin 2 (PRDX2) at amino acid residues 47-48 by the HIV-1 protease
22902630 Two cytosolic peroxiredoxins (Prdx1 and Prdx2) have distinct roles in the cellular peroxide signaling and compete for available peroxide substrate.
22805285 Results show that peroxiredoxin 2 (Prx2) could prevent DNA from undergoing oxidative stress.
22565169 Data suggest that peroxiredoxin 2 may be involved in the persistence of pro-inflammatory cells in chronic inflammation.
22537621 Plasma peroxiredoxins 1 and 2, and tropomyosin 4 were shown to associate with asbestos-exposure, and peroxiredoxin 1 with lung cancer.
22430214 our results strongly suggest that PRDX2 is a targetable 'metabolic adaptor' driver protein implicated in the selective growth of metastatic cells in the lungs by protecting them against oxidative stress.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22215146 Data suggest that SNPs of peroxiredoxin 1, 2 and 6 are not associated with esophageal cancer.
22207736 Study identified peroxiredoxin 2 (PRDX2) as a novel potential tumor suppressor gene in acute myeloid leukemia (AML).
22099303 a physiological function of PrxII as the residential antioxidant safeguard specific to the redox-sensitive VEGFR2
21750082 In beta-thalassemic erythroid cells the reduction of delta-aminolevulinate synthase-2 activity and the increased expression of peroxiredoxin-2 might represent two novel stress-response protective systems.
21539911 Prx2 expression in nucleus and cytoplasm distinctively regulates androgen receptor signaling, is involved in prostate cancer growth, and may promote castration resistance in prostate cancer.
21148313 PrxII is likely to be attributed to a tumor survival factor positively regulating JNK-dependent DNA repair with its inhibition possibly sensitizing cancer cells to chemotherapeutic agents.
21137073 These results establish PRDX 2 as a candidate for chemotherapy responsiveness marker in osteosarcoma.
21119665 High PRDX2 expression in the cytoplasm is associated with uterine cervix carcinogenesis.
20859956 proteomic profiling used to identify the target proteins of miR-122a in hepatocellular carcinoma; PRDXII was identified to be the new target of miR-122a
20840079 Addition of an uncharged derivative of leucine hydroperoxide to intact erythrocytes caused Prx2 oxidation with no concomitant loss in glutathione.
20721618 PRDX2 was up-regulated in women older than 38 years, and its expression in cumulus cells was associated with embryo quality
20646000 Data suggest that anti-Prx2 autoantibodies would be a useful marker for systemic vasculitis and would be involved in the inflammatory processes of systemic vasculitis.
20363977 could act as an autoantigen of a streptococcal-induced autoimmune response and represents a target of the exaggerated T cell response in psoriasis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19896490 Observational study of gene-disease association. (HuGE Navigator)
19716412 Exposure to Chloramines and hypochlorous acid inflammatory oxidants will result in Prx2 oxidation and could compromise the erythrocyte's ability to resist damaging oxidative insult.
19666612 P. falciparum imports the human redox-active protein peroxiredoxin 2 (hPrx-2, hTPx1) into its cytosol.
19584157 Resutls show that three of five autoantibodies, FKBP52, PPIA, and PRDX2, showed significantly increased reactivity in primary breast cancer and CIS compared with healthy controls.
19561357 Deglutathionylation of 2-Cys Prx is specifically catalyzed by Srx.
19424615 Conclude that Prx II and III are upregulated in response to the development of cervical cancer.
19286652 Prx II is more susceptible than Prx I to hyperoxidation and that the majority of the hyperoxidized Prx II formation is reversible. However, the hyperoxidized Prx I showed much less reversibility
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19151395 These results indicate that both nipradilol and timolol possess a novel mechanism of action and function as potent protective agents against oxidative stress.
19061854 Prx2 is a key antioxidant enzyme for the erythrocyte and reveal red blood cells as active oxidant scrubbers in the bloodstream.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18718523 inhibiting peroxiredoxin II sensitizes glioma cells to oxidative stress
18682255 Observational study of gene-disease association. (HuGE Navigator)
18606987 peroxiredoxin (Prx) I and Prx II are specific targets of HDAC6
18606608 The results suggest that Prx II oxidation does not relate to the pathogenesis of IPF/UIP
18593714 analysis of a protein thiosulfinate intermediate in the reduction of cysteine sulfinic acid in peroxiredoxin by human sulfiredoxin
18578994 Silencing of PRDX2 caused decreased rates of Hep3B cell growth and clone formation, increased rates of cell apoptosis, and increased the levels of endogenous ROS and MDA.
18553980 2-cysteine peroxiredoxins from Homo sapiens, Arabidopsis thaliana, and Pisum sativum as well as a carboxy-terminally truncated variant were subjected to isothermal titration calorimetry analysis.
18387321 study reports identification of Prx2 in the erythrocyte membrane from hereditary spherocytosis patients; presence of Prx2 in erythrocyte membranes was linked to higher levels of oxidative stress, as reflected by increased membrane bound hemoglobin
18378575 Significantly decreased expression of Prx-2, -3, and -5 in FED may suggest an alteration in the ability of endothelial cells to withstand oxidant-induced damage and may be closely related to the pathogenesis of this disease.
18022079 Peroxiredoxin II (PRXII) exclusively expressed in bronchiolitis obliterans syndrome.
18003920 observation of increased SNO-Prx2 in human Parkinson's disease (PD) brains, and S-nitrosylation of Prx2 inhibited both its enzymatic activity and protective function from oxidative stress
17601350 Observational study of gene-disease association. (HuGE Navigator)
17524271 PrxII might play an important role in hepatocarcinogenesis and might be used as a molecular target for HCC prevention and treatment.
17519234 Human Prdx1 and Prdx2 possess unique functions and regulatory mechanisms and that Cys(83) bestows a distinctive identity to Prdx1.
17329258 peroxiredoxin 2 has a tertiary structure that facilitates reaction of the active site thiol with hydrogen peroxide while restricting its reactivity with other thiol reagents
17145963 We propose a model in which Prxs function as peroxide dosimeters in subcellular processes that involve redox cycling, with hyperoxidation controlling structural transitions that alert cells of perturbations in peroxide homeostasis.
17105810 in the erythrocyte Prx2 is extremely efficient at scavenging H(2)O(2) noncatalytically
16188094 PDX2 was involved in malignant transformation of human bronchial epithelial cell induced by crystalline nickel sulfide.
15936593 loss of IDPc and Prx-II during tumor development may involve in tumor progression and metastasis
15864612 Prx I and Prx II are induced at the early and late stage of differentiation of normal human epidermal keratinocytes.
15105503 results show that sestrins, a family of proteins whose expression is modulated by p53, are required for regeneration of peroxiredoxins containing Cys-SO(2)H
12963914 Prx II can be used as a novel marker of vascular tumors and preferential expression of Prx II is found in benign vascular tumors.
12943237 decreased expression of PRDX2 may contribute to the altered redox state in Down syndrome at levels comparable to that of the increased expression of SOD1
12650976 Peroxiredoxin 2 levels are significantly increased in the frontal cortex of patients with Down syndrome, Alzheimer and Pick's disease and provides evidence for existence of compensatory response in increased cell loss.
12080185 2-Cys Prxs act in a mutually nonredundant and sometimes stress-specific fashion to protect human cells from oxidant injury. The substantial resistance of human cells to hydroperoxides may result in part from the additive action of multiple Prxs
11904290 Proteomics analysis of cellular response to oxidative stress. Evidence for in vivo overoxidation of peroxiredoxins at their active site
11771746 Protein levels of Prx-I and Prx-II were significantly increased in Alzheimer Disease and Down Syndrome.

AA Sequence

MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGC      1 - 70
EVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQ     71 - 140
ITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN                141 - 198
//

Text Mined References (130)

PMID Year Title
26797130 2016 Oxidative Stress Promotes Peroxiredoxin Hyperoxidation and Attenuates Pro-survival Signaling in Aging Chondrocytes.
26614766 2016 Kinetic analysis of structural influences on the susceptibility of peroxiredoxins 2 and 3 to hyperoxidation.
26601956 2016 Glutathionylation of the Active Site Cysteines of Peroxiredoxin 2 and Recycling by Glutaredoxin.
26548861 2016 Human Peroxiredoxins 1 and 2 and Their Interacting Protein Partners; Through Structure Toward Functions of Biological Complexes.
26021759 2015 An important role for peroxiredoxin II in survival of A549 lung cancer cells resistant to gefitinib.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25786472 2015 Peroxiredoxin 2, glutathione peroxidase, and catalase in the cytosol and membrane of erythrocytes under H2O2-induced oxidative stress.
25471788 2015 Peroxiredoxin 2 is involved in vasculogenic mimicry formation by targeting VEGFR2 activation in colorectal cancer.
25323516 2015 Preoxiredoxin family members (Prx3 and Prx4) and pregnancy disorder (recurrent pregnancy loss).
25264713 2015 Peroxiredoxin-2 recycling is inhibited during erythrocyte storage.
25221425 2014 Proteomic analysis in pterygium; upregulated protein expression of ALDH3A1, PDIA3, and PRDX2.
25097261 2014 Linkage of inflammation and oxidative stress via release of glutathionylated peroxiredoxin-2, which acts as a danger signal.
24952139 2014 Hydrogen peroxide metabolism and sensing in human erythrocytes: a validated kinetic model and reappraisal of the role of peroxiredoxin II.
24909612 2014 Phosphorylation of PrxII promotes JNK-dependent apoptosis in adult cloned pig kidney.
24862795 2014 Peroxiredoxin 2 expression is increased in neutrophils of patients with refractory cytopenia with multilineage dysplasia.
24814289 2014 Peroxiredoxin 2 nuclear levels are regulated by circadian clock synchronization in human keratinocytes.
24750185 2014 Induced nitric oxide synthetase and peroxiredoxin expression in intramucosal poorly differentiated gastric cancer of young patients.
24719319 2014 Nitration transforms a sensitive peroxiredoxin 2 into a more active and robust peroxidase.
24636884 2014 Increased basal oxidation of peroxiredoxin 2 and limited peroxiredoxin recycling in glucose-6-phosphate dehydrogenase-deficient erythrocytes from newborn infants.
24631653 2014 Neuroprotective effect of PEP-1-peroxiredoxin2 on CA1 regions in the hippocampus against ischemic insult.
24631019 2014 Identification of the proteins related to SET-mediated hepatic cytotoxicity of trichloroethylene by proteomic analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24234423 2014 Peroxiredoxin 2 is upregulated in colorectal cancer and contributes to colorectal cancer cells' survival by protecting cells from oxidative stress.
24222118 2013 Human pancreatic cancer cells with acquired gemcitabine resistance exhibit significant up-regulation of peroxiredoxin-2 compared to sensitive parental cells.
24152995 2014 Peroxiredoxin I and II in human eyes: cellular distribution and association with pterygium and DNA damage.
24003226 2013 Molecular basis for the resistance of human mitochondrial 2-Cys peroxiredoxin 3 to hyperoxidation.
23749642 2013 Peroxiredoxin-2 represses melanoma metastasis by increasing E-Cadherin/?-Catenin complexes in adherens junctions.
23713588 2013 Hyperoxidized peroxiredoxin 2 interacts with the protein disulfide- isomerase ERp46.
23603832 2013 Neutrophil-mediated oxidation of erythrocyte peroxiredoxin 2 as a potential marker of oxidative stress in inflammation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23499777 2013 Overexpression of peroxiredoxin 2 in pterygium. A proteomic approach.
23429506 2013 Peroxiredoxin 2 battles poly(ADP-ribose) polymerase 1- and p53-dependent prodeath pathways after ischemic injury.
23393224 2013 Prognostic role of serum AZGP1, PEDF and PRDX2 in colorectal cancer patients.
23123411 2013 Membrane association of peroxiredoxin-2 in red cells is mediated by the N-terminal cytoplasmic domain of band 3.
23113308 2012 Expression of peroxiredoxin 1, 2, 3, and 6 genes in cancer cells during drug resistance formation.
22960070 2012 Peroxiredoxin II is essential for preventing hemolytic anemia from oxidative stress through maintaining hemoglobin stability.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22902630 2012 Peroxiredoxin 1 functions as a signal peroxidase to receive, transduce, and transmit peroxide signals in mammalian cells.
22805285 2012 Biochemical characterization of human peroxiredoxin 2, an antioxidative protein.
22565169 2012 Lymphocytes from rheumatoid arthritis patients have elevated levels of intracellular peroxiredoxin 2, and a greater frequency of cells with exofacial peroxiredoxin 2, compared with healthy human lymphocytes.
22537621 2012 Peroxiredoxins and tropomyosins as plasma biomarkers for lung cancer and asbestos exposure.
22430214 2013 Peroxiredoxin 2 specifically regulates the oxidative and metabolic stress response of human metastatic breast cancer cells in lungs.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22215146 2012 Polymorphisms of peroxiredoxin 1, 2 and 6 are not associated with esophageal cancer.
22207736 2012 Genome-wide analysis of histone H3 acetylation patterns in AML identifies PRDX2 as an epigenetically silenced tumor suppressor gene.
22099303 2011 Peroxiredoxin II is an essential antioxidant enzyme that prevents the oxidative inactivation of VEGF receptor-2 in vascular endothelial cells.
21750082 2011 Oxidative stress modulates heme synthesis and induces peroxiredoxin-2 as a novel cytoprotective response in ?-thalassemic erythropoiesis.
21539911 2011 Peroxiredoxin 2 in the nucleus and cytoplasm distinctly regulates androgen receptor activity in prostate cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21148313 2011 Peroxiredoxin II restrains DNA damage-induced death in cancer cells by positively regulating JNK-dependent DNA repair.
21137073 2010 Peroxiredoxin 2 as a chemotherapy responsiveness biomarker candidate in osteosarcoma revealed by proteomics.
21119665 2011 Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value.
20978343 2010 CD36 participates in a signaling pathway that regulates ROS formation in murine VSMCs.
20859956 2010 Proteomic identification of microRNA-122a target proteins in hepatocellular carcinoma.
20840079 2010 Removal of amino acid, peptide and protein hydroperoxides by reaction with peroxiredoxins 2 and 3.
20721618 2010 Association of creatin kinase B and peroxiredoxin 2 expression with age and embryo quality in cumulus cells.
20646000 2010 Peroxiredoxin 2 is a novel autoantigen for anti-endothelial cell antibodies in systemic vasculitis.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20363977 2010 Ezrin, maspin, peroxiredoxin 2, and heat shock protein 27: potential targets of a streptococcal-induced autoimmune response in psoriasis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19896490 2010 Low 8-oxo-7,8-dihydro-2'-deoxyguanosine levels and influence of genetic background in an Andean population exposed to high levels of arsenic.
19716412 2009 Chloramines and hypochlorous acid oxidize erythrocyte peroxiredoxin 2.
19666612 2009 The malarial parasite Plasmodium falciparum imports the human protein peroxiredoxin 2 for peroxide detoxification.
19584157 2009 Identification of a new panel of serum autoantibodies associated with the presence of in situ carcinoma of the breast in younger women.
19561357 2009 Deglutathionylation of 2-Cys peroxiredoxin is specifically catalyzed by sulfiredoxin.
19424615 2009 Expression of human peroxiredoxin isoforms in response to cervical carcinogenesis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19286652 2009 Novel protective mechanism against irreversible hyperoxidation of peroxiredoxin: Nalpha-terminal acetylation of human peroxiredoxin II.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19151395 2009 Nipradilol and timolol induce Foxo3a and peroxiredoxin 2 expression and protect trabecular meshwork cells from oxidative stress.
19061854 2009 The peroxidase and peroxynitrite reductase activity of human erythrocyte peroxiredoxin 2.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18718523 2008 Decreasing peroxiredoxin II expression decreases glutathione, alters cell cycle distribution, and sensitizes glioma cells to ionizing radiation and H(2)O(2).
18682255 2009 Arsenic metabolism is influenced by polymorphisms in genes involved in one-carbon metabolism and reduction reactions.
18606987 2008 HDAC6 is a specific deacetylase of peroxiredoxins and is involved in redox regulation.
18606608 2008 Peroxiredoxin II expression and its association with oxidative stress and cell proliferation in human idiopathic pulmonary fibrosis.
18593714 2008 Identification of intact protein thiosulfinate intermediate in the reduction of cysteine sulfinic acid in peroxiredoxin by human sulfiredoxin.
18578994 2008 [The biological function of peroxiredoxin II on Hep3B cells and its underlying mechanism].
18553980 2008 Thermodynamics of the dimer-decamer transition of reduced human and plant 2-cys peroxiredoxin.
18479207 2008 Peroxiredoxin 2 and peroxide metabolism in the erythrocyte.
18387321 Presence of cytosolic peroxiredoxin 2 in the erythrocyte membrane of patients with hereditary spherocytosis.
18378575 2008 Decreased expression of peroxiredoxins in Fuchs' endothelial dystrophy.
18022079 2007 Bronchoalveolar lavage fluid proteome in bronchiolitis obliterans syndrome: possible role for surfactant protein A in disease onset.
18003920 2007 S-nitrosylation of peroxiredoxin 2 promotes oxidative stress-induced neuronal cell death in Parkinson's disease.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17524271 2007 [The expression of peroxiredoxin II in hepatocellular carcinoma and its significance].
17519234 2007 Human peroxiredoxin 1 and 2 are not duplicate proteins: the unique presence of CYS83 in Prx1 underscores the structural and functional differences between Prx1 and Prx2.
17329258 2007 The high reactivity of peroxiredoxin 2 with H(2)O(2) is not reflected in its reaction with other oxidants and thiol reagents.
17145963 2006 Oxidation state governs structural transitions in peroxiredoxin II that correlate with cell cycle arrest and recovery.
17141802 2007 Mammalian TIMELESS and Tipin are evolutionarily conserved replication fork-associated factors.
17105810 2007 Peroxiredoxin 2 functions as a noncatalytic scavenger of low-level hydrogen peroxide in the erythrocyte.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16188094 2005 [Identification of protein peroxiredoxin 2 related to crystalline NiS-induced neoplastic transformation].
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
15936593 2005 Identification of differentially expressed proteins during human urinary bladder cancer progression.
15902258 2005 Regulation of PDGF signalling and vascular remodelling by peroxiredoxin II.
15864612 2005 Peroxiredoxin I and II are up-regulated during differentiation of epidermal keratinocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15105503 2004 Regeneration of peroxiredoxins by p53-regulated sestrins, homologs of bacterial AhpD.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12963914 2003 Expression of peroxiredoxin II in vascular tumors of the skin: a novel vascular marker of endothelial cells.
12943237 2003 Peroxiredoxin 2 (PRDX2), an antioxidant enzyme, is under-expressed in Down syndrome fetal brains.
12853451 2003 Regeneration of peroxiredoxins during recovery after oxidative stress: only some overoxidized peroxiredoxins can be reduced during recovery after oxidative stress.
12650976 2003 Aberrant expression of peroxiredoxin subtypes in neurodegenerative disorders.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421812 2003 HIV-1 antiviral activity of recombinant natural killer cell enhancing factors, NKEF-A and NKEF-B, members of the peroxiredoxin family.
12080185 2002 Nonredundant antioxidant defense by multiple two-cysteine peroxiredoxins in human prostate cancer cells.
11981869 2002 Identification of new proteins in follicular fluid of mature human follicles.
11904290 2002 Proteomics analysis of cellular response to oxidative stress. Evidence for in vivo overoxidation of peroxiredoxins at their active site.
11771746 2001 Protein levels of human peroxiredoxin subtypes in brains of patients with Alzheimer's disease and Down syndrome.
11497302 Overexpression of peroxiredoxin in human breast cancer.
11410278 2001 Comparison of the decameric structure of peroxiredoxin-II by transmission electron microscopy and X-ray crystallography.
10873855 2000 Crystal structure of decameric 2-Cys peroxiredoxin from human erythrocytes at 1.7 A resolution.
10841776 2000 Interaction of human thiol-specific antioxidant protein 1 with erythrocyte plasma membrane.
10751418 2000 Chemokines are the main proinflammatory mediators in human monocytes activated by Staphylococcus aureus, peptidoglycan, and endotoxin.
10751410 2000 Identification of a new type of mammalian peroxiredoxin that forms an intramolecular disulfide as a reaction intermediate.
10514471 1999 Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.
9150948 A two-dimensional gel database of human colon carcinoma proteins.
8670254 1996 Glutathione-linked thiol peroxidase activity of human serum albumin: a possible antioxidant role of serum albumin in blood plasma.
8554614 1995 Thioredoxin-linked peroxidase from human red blood cell: evidence for the existence of thioredoxin and thioredoxin reductase in human red blood cell.
8313871 1993 Plasma and red blood cell protein maps: update 1993.
8144038 1994 The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions.
8123012 1994 Purification and characterization of thiol-specific antioxidant protein from human red blood cell: a new type of antioxidant protein.
8041738 1994 Cloning and sequencing of thiol-specific antioxidant from mammalian brain: alkyl hydroperoxide reductase and thiol-specific antioxidant define a large family of antioxidant enzymes.
8026862 1994 Cloning and sequence analysis of candidate human natural killer-enhancing factor genes.
7607688 1995 Localization of TDPX1, a human homologue of the yeast thioredoxin-dependent peroxide reductase gene (TPX), to chromosome 13q12.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.