Property Summary

NCBI Gene PubMed Count 28
PubMed Score 90.40
PubTator Score 69.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Gene RIF (23)

PMID Text
27045445 The article outlines the role of PRDM9 in fertility.
26840484 subspecies-specific degradation of PRDM9 binding sites by meiotic drive, which steadily increases asymmetric PRDM9 binding, has impacts beyond simply changing hotspot positions, and strongly support a direct involvement in hybrid infertility
26833727 Allele C was found to bind a C-specific hot spot with higher affinity than allele A bound A-specific hot spots
26368021 PRDM9 protein variants form functional heteromeric complexes which can bind hotspots sequences. When a heteromeric complex binds at a hotspot of one PRDM9 variant, the other PRDM9 variant, which would otherwise not bind, methylates hotspot nucleosomes
25393762 This depletion of PRDM9 genomic targets is expected to decrease fitness, and thereby to favor new PRDM9 alleles binding different motifs
25001002 Alignment of Neandertal and Denisovan sequences suggests that PRDM9 in archaic hominins was closely related to present-day human alleles that are rare and specific to African populations.
24754746 Results confirm an association between rare variant PRDM9 alleic forms and childhood ALL
24634223 Overexpression of PRDM9 in HEK293 cells also resulted in a significant increase in trimethylated H3K36 and H3K4 further confirming our in vitro observations
23267059 Recombination regulator PRDM9 influences the instability of its own coding sequence in humans.
23222848 We identified PRDM9 as being associated with unusual recombination patterns and discovered a substantial excess of rare allelic forms of PRDM9 in two independent acute lymphoblastic leukemia cohorts.
22643917 observed a increased frequency of PRDM9 variants in parents who transmitted de novo 7q11.23 deletions to their offspring. These data suggest that certain PRDM9 alleles may be associated with an increased susceptibility to recurrent 7q11.23 microdeletions
22162947 discussion of role of PRDM9 in meiotic recombination hotspots; consideration of the structure of the PRDM9 protein [REVIEW]
21750151 Each African-enhanced hotspot is activated by a distinct spectrum of PRDM9 variants, despite the fact that all are predicted to bind the same motif. This differential activation points to complex interactions between the zinc-finger array and hotspots.
20818382 PRDM9 variation strongly influences recombination hot-spot activity and meiotic instability.
20044541 findings implicate the PRDM9 gene in meiotic recombination; involvement of PRDM9, which causes histone H3 lysine 4 trimethylation, implies that there is a common mechanism for recombination hotspots in eukaryotes
20044539 results provide a molecular basis for the distribution of meiotic recombination in mammals in which the binding of PRDM9 to specific DNA sequences targets the initiation of recombination at specific locations in the genome
20044538 sequence of exon 12 of PRDM9; human populations exhibit two predominant alleles and multiple minor alleles of Prdm9
20041164 Human coding polymorphism and interspecies evolutionary changes in the PRDM9 gene, was analyzed.
19168450 Our results suggest that mutations in PRDM9 may cause idiopathic infertility in human males.
19168450 Observational study of gene-disease association. (HuGE Navigator)
18941885 Results show a possible association between PRDM9 and azoospermia by meiotic arrest.
18941885 Observational study of gene-disease association. (HuGE Navigator)
18231586 Evolutionary analysis suggests that human PRDM7 and PRDM9 genes, a pair of close paralogs corresponding to a single mouse gene Prdm9, were generated by a recent gene duplication event after the divergence of the ancestors of human and mouse.

AA Sequence

MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNALITIGLRATR      1 - 70
PAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMPKASFSNESSLKELSRTANLL     71 - 140
NASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKMYSLRERKGHAYKEVSEPQDDDYLYCEMCQN    141 - 210
FFIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRI    211 - 280
TEDEEAANNGYSWLITKGRNCYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPG    281 - 350
CELLVWYGDEYGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS    351 - 420
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPPKGQMGSCRVG    421 - 490
KRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVITHQRTHTGEKLYVCRECGRG    491 - 560
FSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSRQSVLLTHQRRH    561 - 630
TGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRG    631 - 700
FSWQSVLLTHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTH    701 - 770
TGEKPYVCRECGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG    771 - 840
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE                    841 - 894
//

Text Mined References (30)

PMID Year Title
27045445 2016 X marks the spot: PRDM9 rescues hybrid sterility by finding hidden treasure in the genome.
26840484 2016 Re-engineering the zinc fingers of PRDM9 reverses hybrid sterility in mice.
26833727 2016 Structural basis for human PRDM9 action at recombination hot spots.
26368021 2015 Multimer Formation Explains Allelic Suppression of PRDM9 Recombination Hotspots.
25395542 2014 DNA recombination. Recombination initiation maps of individual human genomes.
25393762 2014 The red queen model of recombination hotspots evolution in the light of archaic and modern human genomes.
25001002 2014 Primate evolution of the recombination regulator PRDM9.
24754746 2014 Allelic variants of PRDM9 associated with high hyperdiploid childhood acute lymphoblastic leukaemia.
24634223 2014 Trimethylation of histone H3 lysine 36 by human methyltransferase PRDM9 protein.
24136506 2013 Meiotic recombination in mammals: localization and regulation.
23267059 2013 Recombination regulator PRDM9 influences the instability of its own coding sequence in humans.
23222848 2013 Rare allelic forms of PRDM9 associated with childhood leukemogenesis.
22643917 2012 Evaluation of PRDM9 variation as a risk factor for recurrent genomic disorders and chromosomal non-disjunction.
22162947 2011 The case of the fickle fingers: how the PRDM9 zinc finger protein specifies meiotic recombination hotspots in humans.
21775986 2011 The landscape of recombination in African Americans.
21750151 2011 Variants of the protein PRDM9 differentially regulate a set of human meiotic recombination hotspots highly active in African populations.
20981099 2010 Fine-scale recombination rate differences between sexes, populations and individuals.
20818382 2010 PRDM9 variation strongly influences recombination hot-spot activity and meiotic instability in humans.
20044541 2010 Drive against hotspot motifs in primates implicates the PRDM9 gene in meiotic recombination.
20044539 2010 PRDM9 is a major determinant of meiotic recombination hotspots in humans and mice.
20044538 2010 Prdm9 controls activation of mammalian recombination hotspots.
20041164 2009 Extraordinary molecular evolution in the PRDM9 fertility gene.
19168450 Single-nucleotide polymorphisms of the PRDM9 (MEISETZ) gene in patients with nonobstructive azoospermia.
18941885 Two single nucleotide polymorphisms in PRDM9 (MEISETZ) gene may be a genetic risk factor for Japanese patients with azoospermia by meiotic arrest.
18231586 2008 Genome-wide survey and developmental expression mapping of zebrafish SET domain-containing genes.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14675547 2003 SET domains and histone methylation.
10668202 2000 The yin-yang of PR-domain family genes in tumorigenesis.
2062643 1991 Two hypervariable minisatellite DNA binding proteins.