Property Summary

NCBI Gene PubMed Count 61
PubMed Score 124.70
PubTator Score 112.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.400 8.5e-03
interstitial lung disease 1.100 5.7e-04
malignant mesothelioma 1.300 1.4e-05
astrocytic glioma -1.700 2.4e-03
ependymoma -2.900 1.7e-25
oligodendroglioma -1.800 1.0e-02
psoriasis -2.200 9.8e-06
glioblastoma -2.700 9.7e-09
osteosarcoma -1.941 1.2e-05
medulloblastoma -2.000 9.4e-07
atypical teratoid / rhabdoid tumor -3.200 2.4e-13
medulloblastoma, large-cell -3.100 1.1e-06
primitive neuroectodermal tumor -1.900 2.9e-04
adult high grade glioma -2.600 2.3e-07
pilocytic astrocytoma -2.200 3.9e-10
subependymal giant cell astrocytoma -2.510 1.8e-02
Pick disease -1.400 3.5e-02
acute myeloid leukemia 1.100 1.9e-02

Gene RIF (50)

PMID Text
26690953 RIZ1 expression is negatively correlated with glioma differentiation and can serve as a predictor of glioma prognosis and thus could be a potential therapeutic target for patients with gliomas.
25987089 Loss of RIZ1 expression due to methylation is associated with Renal Cell Carcinoma.
25884948 PRDM2 downregulation may play a role in dopamine-agonist resistance and tumor recurrence in prolactinomas.
24993551 Results suggest that high expression of SMYD3 is related to the occurrence of esophageal squamous cell carcinoma. Also, its suppression promoted the expression of RIZ1 suggesting a signal transduction pathway between SMYD3 and RIZ1.
24966940 PRDM2, PRDM5, PRDM16 promoters are methylated and their expression is suppressed in lung cancer cells.
24115813 The development and progression of esophageal squamous cell carcinoma are related to the inactivation of RIZ1.
23098508 Reduction of RIZ1 expression aggravates the progression of liver fluke-related cholangiocarcinoma
22614009 RIZ1 expression is significantly downregulated as the formation of meningiomas progressed, and suggest that RIZ1 may represent a promising candidate tumor suppressor gene that contributes to malignant meningiomas.
22372344 RIZ1 may be a potential tumor suppressor in human esophageal squamous cell cancer.
22363126 Data suggest that promoter methylation may play an important role in the epigenetic silencing of RIZ1 gene expression in human esophageal squamous cell carcinoma.
22300346 Aberrant methylation and decreased expression of the RIZ1 gene are frequent in adult acute lymphoblastic leukemia of T-cell phenotype
21503890 Acting as a negative regulator of RIZ1 function, PRFM2 mediates effect of cell proliferation by estrogen via regulation of cell survival and differentiating gene expression.
21369371 RIZ1 might play an important role in tumor metastasis, and the PR domain alone possessed anticancer activity.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20960050 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20878080 RIZ1 promoter methylation is not a common event in neuroblastoma.
20828818 Results suggest that the RIZ1 gene is inactivated in MDS and AML in part by methylation, whereas another mechanism should be involved in others.
20675009 promoter methylation and H3K9 modifications work together to silence the RIZ1 gene in hepatocellular carcinoma (HCC).
20594067 RIZ1 negatively regulated the cell proliferation of monocytic leukemia cells via activation of p53.
20508921 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20159667 Reduced expression of RIZ1 may play an important role in the pathogenesis and/or development of cervical cancer, and is considered to be caused in part by aberrant DNA methylation
19843671 Observational study of gene-disease association. (HuGE Navigator)
19746436 RIZ1 is expressed in normal prostate epithelial cells and down-regulated in cancer cells, with a switch of its localization from the nucleus to the cytoplasm upon cancer grade progression. RIZ1 levels were modulated by DHT or E2 treatment in vitro.
19602237 Loss of RIZ1 expression will lead to an increase in myeloid blast cell population resulting in CML progression.
19460752 Knockdown of PR domain containing 2, with ZNF domain (PRDM2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19124506 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18852888 methyl-balanced diet conferred additional survival benefits compared to a tumor-inducing methyl-imbalanced diet only in mice with wild type RIZ1 but not in mice deficient in RIZ1
18712668 Results suggest that the inactivation of the RIZ1 by DNA methylation at its promoter region is involved in the tumorigenesis of hepatocellular carcinoma, particularly in the early stage of disease.
18488713 Silencing of YY1 downregulates RIZ1 promoter in human osteosarcoma.
18037365 observed no association of the RIZ1 Pro704 insertion-deletion polymorphism with BMD or fracture risk
18037365 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17963297 The proliferation, migration induction and apoptosis inhibition activities of SMYD3 in hepatocellular carcinoma may be mediated through RIZ1 CpG promoter hypermethylation.
17922684 Reduced expression of RIZ1 may play an important role in the pathogenesis and/or development of epithelial ovarian carcinoma, and is considered to be caused in part by aberrant DNA methylation.
17693662 RIZ polymorphisms may be important predictive markers for lung cancer susceptibility.
17693662 Observational study of gene-disease association. (HuGE Navigator)
17356055 the ERalpha cofactor RIZ gene has a prominent effect on bone marrow density(BMD), and the P704 genotype modulates the impact of estradiol on BMD
17205536 A563G variant not found in diffuse large B-cell lymphomas.
17103461 The current study suggested an important role for RIZ1 expression in thyroid tumorigenesis.
16953217 Forced RIZ1 expression in CML-BC cell lines decreases IGF-1 receptor activation and activation of downstream signaling components extracellular signal-regulated kinase 1/2 and AKT
16501248 Observational study of gene-disease association. (HuGE Navigator)
15809732 recurrent inactivation of the tumour suppressor RIZ1 suggests that this event may be a significant contributing factor to tumour development in pheochromocytomas and abdominal paragangliomas
15579774 RIZ1 may be a new candidate gene for involvement in the variation seen in bone mineral density.
15488642 the presented results indicated that the Zn-finger domain could be endowed with the putative oncogenic activity of RIZ2 gene product.
15309726 Frameshift mutations of RIZ may play an important role in gastric cancers with microsatellite instability.
14633678 Tumor suppressor RIZ1 (PRDM2) methylates histone H3 on lysine 9, and this activity is reduced by mutations in the PR domain found in human cancers.
14534544 RIZ1 in gastric neoplasms undergoes biallelic inactivation.
12082534 Frameshift mutations of RIZ, but no point mutations, were found in RIZ1 exons in malignant melanomas with deletions in 1p36. RIZ has potential role in the multi-step tumor forming process of malignant melanoma of the skin.
12002276 These findings suggest that RIZ may be a possible target of structural alteration leading to leukemia.
11719434 loss of RIZ1 mRNA in human cancers is associated with DNA methylation of its promoter CpG island.

AA Sequence

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK      1 - 70
NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY     71 - 140
NGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPK    141 - 210
EDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEE    211 - 280
EEDDDDDELEDEGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEA    281 - 350
NGDVFETFMFPCQHCERKFTTKQGLERHMHIHISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKP    351 - 420
SQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSSVVEENGEVKELHPCKYCKK    421 - 490
VFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVYVPSTEPEEEGEADDVYIMDISS    491 - 560
NISENLNYYIDGKIQTNNNTSNCDVIEMESASADLYGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLG    561 - 630
STNSEAKKRRTASPPALPKIKAETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVYLSSKLKQLLQTQDK    631 - 700
LTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPPSSPQHSPALRDFGKPSDGKAAWTDAGLTS    701 - 770
KKSKLESHSDSPAWSLSGRDERETVSPPCFDEYKMSKEWTASSAFSSVCNQQPLDLSSGVKQKAEGTGKT    771 - 840
PVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNEYNGIDLPVENPADGT    841 - 910
RSPSPCKSLEAQPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVL    911 - 980
TVATPPPPLLPTVPLPAPSSSASPHPCPSPLSNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPT    981 - 1050
LSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFKQEELENEGLKPREEPQSAA   1051 - 1120
EQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNI   1121 - 1190
FVCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEE   1191 - 1260
ELNDSSEELYTTIKIMASGIKTKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFT   1261 - 1330
TAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQP   1331 - 1400
KRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCNREFTYIGSL   1401 - 1470
NKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSG   1471 - 1540
PTQVPLPSSSFRSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRS   1541 - 1610
LHVRVQKSKAVLQSKSTLASKKRTDRFNIKSRERSGGPVTRSLQLAAAADLSENKREDGSAKQELKDFSY   1611 - 1680
SLRLASRCSPPAAPYITRQYRKVKAPAAAQFQGPFFKE                                   1681 - 1718
//

Text Mined References (70)

PMID Year Title
26690953 2015 RIZ1: a potential tumor suppressor in glioma.
25987089 2015 Aberrant Methylation of the 1p36 Tumor Suppressor Gene RIZ1 in Renal Cell Carcinoma.
25884948 2015 Lower PRDM2 expression is associated with dopamine-agonist resistance and tumor recurrence in prolactinomas.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24993551 2014 Effect of the downregulation of SMYD3 expression by RNAi on RIZ1 expression and proliferation of esophageal squamous cell carcinoma.
24966940 2014 Methylation of PRDM2, PRDM5 and PRDM16 genes in lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24115813 2013 Alteration in gene expression profile and oncogenicity of esophageal squamous cell carcinoma by RIZ1 upregulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098508 2012 Contribution of RIZ1 to regulation of proliferation and migration of a liver fluke-related cholangiocarcinoma cell.
22614009 2013 Retinoblastoma protein-interacting zinc-finger gene 1 (RIZ1) dysregulation in human malignant meningiomas.
22372344 2012 Decreased expression of retinoblastoma protein-interacting zinc-finger gene 1 in human esophageal squamous cell cancer by DNA methylation.
22363126 2012 Study on RIZ1 gene promoter methylation status in human esophageal squamous cell carcinoma.
22300346 2012 Aberrant methylation and decreased expression of the RIZ1 gene are frequent in adult acute lymphoblastic leukemia of T-cell phenotype.
21503890 2012 Identification of a functional estrogen-responsive enhancer element in the promoter 2 of PRDM2 gene in breast cancer cell lines.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21369371 2011 Anticancer activity of the PR domain of tumor suppressor RIZ1.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20960050 2011 Dietary methyl donors, methyl metabolizing enzymes, and epigenetic regulators: diet-gene interactions and promoter CpG island hypermethylation in colorectal cancer.
20878080 2010 Suppression of RIZ in biologically unfavourable neuroblastomas.
20828818 2011 Aberrant methylation of the RIZ1 gene in myelodysplastic syndrome and acute myeloid leukemia.
20675009 2010 Epigenetic inactivation of the tumor suppressor gene RIZ1 in hepatocellular carcinoma involves both DNA methylation and histone modifications.
20594067 2010 Retinoblastoma protein-interacting zinc finger 1 (RIZ1) regulates the proliferation of monocytic leukemia cells via activation of p53.
20508921 2010 Genotypes and haplotypes of the estrogen receptor genes, but not the retinoblastoma-interacting zinc finger protein 1 gene, are associated with osteoporosis.
20159667 2010 DNA methylation of the RIZ1 tumor suppressor gene plays an important role in the tumorigenesis of cervical cancer.
20084102 2010 Structural biology of human H3K9 methyltransferases.
19843671 2009 Genetic variants of methyl metabolizing enzymes and epigenetic regulators: associations with promoter CpG island hypermethylation in colorectal cancer.
19746436 2009 Expression of RIZ1 protein (Retinoblastoma-interacting zinc-finger protein 1) in prostate cancer epithelial cells changes with cancer grade progression and is modulated in vitro by DHT and E2.
19602237 2009 RIZ1 is potential CML tumor suppressor that is down-regulated during disease progression.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18852888 2008 Requirement of RIZ1 for cancer prevention by methyl-balanced diet.
18712668 2008 Hyper-methylation of RIZ1 tumor suppressor gene is involved in the early tumorigenesis of hepatocellular carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18488713 2008 Silencing of YY1 downregulates RIZ1 promoter in human osteosarcoma.
18082620 2008 Structural studies of the SET domain from RIZ1 tumor suppressor.
18037365 2008 The RIZ Pro704 insertion-deletion polymorphism, bone mineral density and fracture risk: the Rotterdam study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17963297 2007 Silencing SMYD3 in hepatoma demethylates RIZI promoter induces apoptosis and inhibits cell proliferation and migration.
17922684 2007 Decreased expression of RIZ1 and its clinicopathological significance in epithelial ovarian carcinoma: correlation with epigenetic inactivation by aberrant DNA methylation.
17693662 2007 Genetic polymorphisms in the Rb-binding zinc finger gene RIZ and the risk of lung cancer.
17356055 2007 The impact of estradiol on bone mineral density is modulated by the specific estrogen receptor-alpha cofactor retinoblastoma-interacting zinc finger protein-1 insertion/deletion polymorphism.
17205536 2007 Lack of A563G (I188V) missense mutation in RIZ/ PRDM2 in human diffuse large B-cell lymphomas.
17103461 2006 RIZ1 is epigenetically inactivated by promoter hypermethylation in thyroid carcinoma.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16953217 2007 RIZ1 repression is associated with insulin-like growth factor-1 signaling activation in chronic myeloid leukemia cell lines.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16501248 2006 Genetic variants in epigenetic genes and breast cancer risk.
15809732 2005 Deletions and altered expression of the RIZ1 tumour suppressor gene in 1p36 in pheochromocytomas and abdominal paragangliomas.
15579774 2004 A deletion polymorphism in the RIZ gene, a female sex steroid hormone receptor coactivator, exhibits decreased response to estrogen in vitro and associates with low bone mineral density in young Swedish women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488642 2004 The Zn-finger domain of RIZ protein promotes MCF-7 cell proliferation.
15309726 2004 Detection of frameshift mutations of RIZ in gastric cancers with microsatellite instability.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14633678 2003 Inactivation of a histone methyltransferase by mutations in human cancers.
14534544 2003 Biallelic inactivation of the RIZ1 gene in human gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472571 2002 Altered expression of retinoblastoma protein-interacting zinc finger gene, RIZ, in human leukaemia.
12002276 2002 Nucleotide alteration of retinoblastoma protein-interacting zinc finger gene, RIZ, in human leukemia.
11544182 2001 Tumor formation and inactivation of RIZ1, an Rb-binding member of a nuclear protein-methyltransferase superfamily.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10706618 2000 The retinoblastoma-interacting zinc-finger protein RIZ is a downstream effector of estrogen action.
9766644 1998 RIZ1, but not the alternative RIZ2 product of the same gene, is underexpressed in breast cancer, and forced RIZ1 expression causes G2-M cell cycle arrest and/or apoptosis.
9334209 1997 Transcriptional repression mediated by the PR domain zinc finger gene RIZ.
9006946 1997 The retinoblastoma interacting zinc finger gene RIZ produces a PR domain-lacking product through an internal promoter.
8661032 1996 Physical mapping of the retinoblastoma interacting zinc finger gene RIZ to D1S228 on chromosome 1p36.
8654390 1996 cDNA cloning of a novel protein containing two zinc-finger domains that may function as a transcription factor for the human heme-oxygenase-1 gene.
7590293 1995 Identification and cloning of the G3B cDNA encoding a 3' segment of a protein binding to GATA-3.
7538672 1995 The retinoblastoma protein binds to RIZ, a zinc-finger protein that shares an epitope with the adenovirus E1A protein.