Property Summary

NCBI Gene PubMed Count 32
PubMed Score 83.04
PubTator Score 216.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
urothelial carcinoma -1.200 4.7e-02
malignant mesothelioma -2.900 1.3e-08
astrocytoma 1.700 8.4e-03
glioblastoma multiforme 1.100 7.2e-23
oligodendroglioma 1.100 2.4e-14
juvenile dermatomyositis 1.057 1.4e-08
pancreatic ductal adenocarcinoma liver m... -1.216 5.8e-03
intraductal papillary-mucinous carcinoma... -1.300 7.8e-03
lung cancer 1.100 8.3e-04
diabetes mellitus -1.400 8.6e-03
posterior fossa group B ependymoma 1.600 3.0e-12
non primary Sjogren syndrome sicca -1.100 1.9e-02
ovarian cancer -1.700 4.0e-08

Protein-protein Interaction (1)

Gene RIF (21)

PMID Text
25370794 The decrease in PRCP levels in the first 24 h after stroke onset is associated with stroke severity and an unfavourable short-term stroke outcome
25324000 PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation.
23744584 PRCP regulates cell growth, angiogenesis, and the response to vascular injury
22679278 The present results indicated PRCP rs7104980 can be considered as a marker for EH and Hap3 GAGCACTAACA (PRCP) and Hap16 TTTA (CMA1) might be associated with essential hypertension in Chinese Han population.
22079761 analysis of non-benzimidazole and brain-penetrant prolylcarboxypeptidase inhibitors
21087932 PRCP as a resistance factor for 4OHTAM resistance in estrogen receptor-positive breast cancer cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20540760 A structure-based alignment with the previously undescribed structure of DPP7 illuminates the mechanism of orthogonal substrate specificity of PRCP and DPP7.
20517885 A single peptide, with the sequence YPRPIHPA, as a novel substrate for PRCP in human cerebrospinal fluid.
20516604 Purified PrCP yielded crystals belonging to space group R32, with unit-cell parameters a = b = 181.14, c = 240.13 A, that diffracted to better than 2.8 A resolution.
20079160 Data suggest that the E112D polymorphism in the PRCP gene may be a useful genetic marker to predict the antihypertensive effect of short-term benazepril treatment in hypertensive patients.
20079160 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18656443 These investigations showed that the C-terminal region of the rPRCP(40) contributes to PRCP's catalytic function, and provided additional experimental evidence for this suggestion.
18396440 role in regulation cardiovascular tone; proinflammatory agent
16681991 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16681991 Prolylcarboxypepdiase E112D (rs2298668)D allele alone and jointly with chronic hypertension were associated with a significantly increased risk of preeclampsia
14996700 recombinant protein, identical to enzyme from human umbilical vein endothelial cells, is a prekallikrein activator.
12768436 Observational study of genotype prevalence. (HuGE Navigator)
12123826 Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.
11830581 PRCP appears to be a HUVEC-associated prekallikrein activator.

AA Sequence

MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQ      1 - 70
RYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSR     71 - 140
HLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFE    141 - 210
DLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS    211 - 280
ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETA    281 - 350
TSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT    351 - 420
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYD    421 - 490
SAGKQH                                                                    491 - 496
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25370794 2015 Prolyl carboxypeptidase activity decline correlates with severity and short-term outcome in acute ischemic stroke.
25324000 2014 Prolylcarboxypeptidase independently activates plasma prekallikrein (fletcher factor).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23744584 2013 Prolylcarboxypeptidase promotes angiogenesis and vascular repair.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22679278 2013 Association of polymorphisms in prolylcarboxypeptidase and chymase genes with essential hypertension in the Chinese Han population.
22079761 2012 The discovery of non-benzimidazole and brain-penetrant prolylcarboxypeptidase inhibitors.
21269460 2011 Initial characterization of the human central proteome.
21087932 2011 Prolylcarboxypeptidase regulates proliferation, autophagy, and resistance to 4-hydroxytamoxifen-induced cytotoxicity in estrogen receptor-positive breast cancer cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20540760 2010 Structural definition and substrate specificity of the S28 protease family: the crystal structure of human prolylcarboxypeptidase.
20517885 2010 Peptidomic profiling of human cerebrospinal fluid identifies YPRPIHPA as a novel substrate for prolylcarboxypeptidase.
20516604 2010 Expression, purification and crystallization of human prolylcarboxypeptidase.
20079160 2009 E112D polymorphism in the prolylcarboxypeptidase gene is associated with blood pressure response to benazepril in Chinese hypertensive patients.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18656443 2008 The functional importance of the N-terminal region of human prolylcarboxypeptidase.
18396440 2009 Prolylcarboxypeptidase: a cardioprotective enzyme.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16681991 2006 Prolylcarboxypeptidase gene, chronic hypertension, and risk of preeclampsia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14996700 2004 Recombinant prolylcarboxypeptidase activates plasma prekallikrein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12768436 2003 Characterization of 458 single nucleotide polymorphisms of disease candidate genes in the Korean population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12123826 2002 Identification of prolylcarboxypeptidase as the cell matrix-associated prekallikrein activator.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9325062 1997 The human angiotensinase C gene (HUMPCP) maps to 11q14 within 700 kb of D11S901: a candidate gene for essential hypertension.
8344943 1993 Sequencing and cloning of human prolylcarboxypeptidase (angiotensinase C). Similarity to both serine carboxypeptidase and prolylendopeptidase families.
7626287 1995 Plasma membrane-bound and lysosomal peptidases in human alveolar macrophages.
4297812 1968 New enzymatic route for the inactivation of angiotensin.
28321 1978 Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney.