Property Summary

Ligand Count 320
NCBI Gene PubMed Count 33
PubMed Score 85.87
PubTator Score 216.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma 1.200 7.8e-20
diabetes mellitus -1.400 8.6e-03
glioblastoma multiforme 1.100 7.2e-23
intraductal papillary-mucinous carcinoma... -1.300 7.8e-03
juvenile dermatomyositis 1.057 1.4e-08
lung cancer 1.100 8.3e-04
malignant mesothelioma -2.900 1.3e-08
non primary Sjogren syndrome sicca -1.100 1.9e-02
oligodendroglioma 1.100 2.4e-14
ovarian cancer -1.700 4.0e-08
pancreatic ductal adenocarcinoma liver m... -1.216 5.8e-03
posterior fossa group A ependymoma 1.300 1.8e-08
urothelial carcinoma -1.200 4.7e-02

Gene RIF (22)

AA Sequence

MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQ      1 - 70
RYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSR     71 - 140
HLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFE    141 - 210
DLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS    211 - 280
ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETA    281 - 350
TSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT    351 - 420
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYD    421 - 490
SAGKQH                                                                    491 - 496
//

Text Mined References (39)

PMID Year Title