Property Summary

NCBI Gene PubMed Count 19
PubMed Score 119.62
PubTator Score 117.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma 1.176 8.1e-06
lung cancer 1.200 1.2e-03
osteosarcoma -1.423 5.2e-03
ovarian cancer 1.100 2.4e-05
psoriasis -1.500 2.8e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (3)

AA Sequence

MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAPAFPPPLLLPP      1 - 70
PTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGLNLPPPIGGAGPPLGLPKPKK     71 - 140
RKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSD    141 - 210
GSPDTKPSRLASKTKTSSLAPVVGTTTTTPSPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLP    211 - 280
EKAEPPGVEPYPYPIPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTY    281 - 350
GDANAAGAYYQDYYSGGYYPAQDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS    351 - 420
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG    421 - 490
F//

Text Mined References (28)

PMID Year Title