Property Summary

NCBI Gene PubMed Count 45
PubMed Score 4.86
PubTator Score 119.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (30)

Disease log2 FC p
chronic lymphosyte leukemia 1.100 3.4e-05
psoriasis 2.000 1.9e-03
glioblastoma 2.200 3.8e-08
group 3 medulloblastoma 3.100 2.7e-06
atypical teratoid/rhabdoid tumor 2.200 1.7e-08
medulloblastoma, large-cell 2.500 4.4e-06
primitive neuroectodermal tumor 2.200 6.6e-04
Atopic dermatitis 1.300 1.7e-04
adrenocortical carcinoma 3.873 2.6e-08
non-small cell lung cancer 3.437 2.3e-33
intraductal papillary-mucinous carcinoma... 2.800 2.2e-04
intraductal papillary-mucinous neoplasm ... 3.000 8.3e-04
lung cancer 3.100 1.3e-05
colon cancer 1.300 4.5e-03
pancreatic cancer 1.400 2.9e-06
breast carcinoma 1.900 6.4e-37
interstitial cystitis 1.200 1.6e-03
lung adenocarcinoma 1.400 1.4e-06
pediatric high grade glioma 2.100 3.7e-05
posterior fossa group A ependymoma 1.500 1.6e-04
primary Sjogren syndrome 1.200 5.2e-04
subependymal giant cell astrocytoma -1.108 2.0e-02
nasopharyngeal carcinoma 1.600 1.1e-05
Endometriosis 2.037 5.7e-03
Breast cancer 2.800 2.9e-12
ductal carcinoma in situ 2.600 6.2e-04
invasive ductal carcinoma 3.300 5.9e-05
ulcerative colitis 1.100 9.8e-04
ovarian cancer 2.200 2.1e-04
pituitary cancer 1.500 2.9e-04

Gene RIF (28)

PMID Text
26898432 These findings suggest that the aberrant expression of PRC1 may predict biochemical recurrence in men with prostate cancer highlighting its potential as a prognostic marker of this malignancy.
24725408 Study finds that frictional forces increase nonlinearly with microtubule-associated proteins (MAP) velocity across microtubules and depend on filament polarity, with NuMA's friction being lower when moving toward minus ends, EB1's lower toward plus ends, and PRC1's exhibiting no directional preference.
24460908 The presence of CBX4 or CBX8-GFP in the same focus had a minor impact on BMI1 and RING1 recovery kinetics.
24120663 PP2A-B55 dephosphorylates PRC1 at the metaphase to anaphase transition. This activity is regulated by the Greatwall (MASTL) kinase and its substrate ENSA, explaining the timing of PRC1 activation in anaphase.
23870126 Studies reveal how interactions between the conserved nonmotor MAP, PRC1, and the motor protein, kinesin-4, generate filament length-dependent tags at microtubule plus ends. PRC1 tags ends of microtubules in dividing cells and the size of these tags increases linearly with filament length.
23349393 Different PRC1 paralog family members have nonredundant and locus-specific gene regulatory activities that are essential for human hematopoiesis.
22621898 findings suggest that PRC1 is regulated by Plk1, rather than Cdk1 as previously proposed, because its activity must be spatiotemporally regulated both preanaphase and postanaphase, and Cdk1 activity is too binary for this purpose
22419124 Two distinct mechanisms are involved in CBX2-mediated gene silencing. The short CBX2-2 isoform would repress the transcription in a PRC1-independent fashion, whereas gene repression by the long CBX2-1 isoform is mediated by the PRC1 protein complex.
22323288 Cells depleted of PRC1 failed to form a polarized microtubule array or ectopic furrows following mitotic exit, and recruitment of Aurora B kinase, male germ cell Rac GTPase-activating protein, and RhoA to the cortex was impaired.
20889853 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20691902 PRC1's microtubule binding is mediated by a structured domain with a spectrin-fold and an unstructured Lys/Arg-rich domain.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19664331 The radiosensitizing effect of paclitaxel on KB cells may be due to the down-regulated expression of PRC1 and cyclin B2.
19609347 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19561070 Data propose that PRC1 forms a link between stabilization of CLASP1 association with central spindle microtubules and anti-parallel microtubule elongation.
19468300 Microtubule-associated protein (MAP) Prc1 facilitate Plk1 phosphorylation of HsCyk-4.
18570919 These results provide a potential mechanistic basis for the defective cytokinesis phenotype exhibited by HSF2-/- cells, as well as suggest a potential role for PRC1 in HSF2-mediated gene bookmarking.
17351640 PRC1 is a docking partner for the Polo kinase Plk1 in anaphase cells. During metaphase this is inhibited by Cdk1-cyclin B phosphorylation at T470 and T481.
17233835 suggest the involvement of a PRC1- kinesin family member 2C/mitotic centromere-associated kinesin complex in breast tumorigenesis, and this complex should be a promising target for the development of novel treatments for breast cancer
16603632 PRC1 is an essential factor in controlling the spatiotemporal formation of the midzone in human cells.
16431929 PRC1 complexes isolated from human cells contain multiple kinesins KIF4A, Kif20A, KIF23 and KIF14.
15625105 role of PRC1 in midzone formation, indicate that cell cycle-dependent translocation of PRC1 by Kif4 is essential for midzone formation and cytokinesis.
15616196 PRC1 is a microtubule bundling protein that is critical to the formation of the central spindle, which is required for abscission but not for furrowing in mammalian cells
15531928 transcription is controlled by p53 via regulating cytokinesis
15297875 kinesin family member 4 and its binding partner PRC1 play essential roles in the organization of central spindles and midzone formation
14744859 contributes to the correct formation of the spindle during the metaphase
12082078 PRC1 is a microtubule-associated protein required to maintain the spindle midzone, and that distinct functions are associated with modular elements of the primary sequence.

AA Sequence

MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS      1 - 70
VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHY     71 - 140
DIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCL    141 - 210
SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD    211 - 280
RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE    281 - 350
LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA    351 - 420
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT    421 - 490
TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGY    491 - 560
PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS              561 - 620
//

Text Mined References (57)

PMID Year Title
26898432 2016 Protein regulator of cytokinesis 1 overexpression predicts biochemical recurrence in men with prostate cancer.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24725408 2014 Asymmetric friction of nonmotor MAPs can lead to their directional motion in active microtubule networks.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24460908 2014 PRC1 components exhibit different binding kinetics in Polycomb bodies.
24120663 2013 The BEG (PP2A-B55/ENSA/Greatwall) pathway ensures cytokinesis follows chromosome separation.
23870126 2013 Marking and measuring single microtubules by PRC1 and kinesin-4.
23349393 2013 Nonredundant and locus-specific gene repression functions of PRC1 paralog family members in human hematopoietic stem/progenitor cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22621898 2012 Plk1 negatively regulates PRC1 to prevent premature midzone formation before cytokinesis.
22419124 2012 A human Polycomb isoform lacking the Pc box does not participate to PRC1 complexes but forms protein assemblies and represses transcription.
22323288 2012 PRC1 controls spindle polarization and recruitment of cytokinetic factors during monopolar cytokinesis.
22278743 2012 Midbody assembly and its regulation during cytokinesis.
21693658 2011 Small RNA sequencing and functional characterization reveals MicroRNA-143 tumor suppressor activity in liposarcoma.
21269460 2011 Initial characterization of the human central proteome.
20962590 2010 Role of a novel coiled-coil domain-containing protein CCDC69 in regulating central spindle assembly.
20889853 2011 Genetic risk reclassification for type 2 diabetes by age below or above 50 years using 40 type 2 diabetes risk single nucleotide polymorphisms.
20691902 2010 Insights into antiparallel microtubule crosslinking by PRC1, a conserved nonmotor microtubule binding protein.
20581827 2010 Twelve type 2 diabetes susceptibility loci identified through large-scale association analysis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19664331 2009 [Molecular mechanism of radiosensitizing effect of paclitaxel].
19609347 2009 A genome-wide association study of hypertension and blood pressure in African Americans.
19561070 2009 PRC1 cooperates with CLASP1 to organize central spindle plasticity in mitosis.
19468300 2009 Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18587273 2008 Transcriptional targeting of gene expression in breast cancer by the promoters of protein regulator of cytokinesis 1 and ribonuclease reductase 2.
18570919 2008 PRC1 associates with the hsp70i promoter and interacts with HSF2 during mitosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17438553 2007 Mitotic phosphorylation of PRC1 at Thr470 is required for PRC1 oligomerization and proper central spindle organization.
17409436 2007 Oncogenic role of MPHOSPH1, a cancer-testis antigen specific to human bladder cancer.
17351640 2007 Choice of Plk1 docking partners during mitosis and cytokinesis is controlled by the activation state of Cdk1.
17233835 2007 Elevated expression of protein regulator of cytokinesis 1, involved in the growth of breast cancer cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16603632 2006 Spatiotemporal control of spindle midzone formation by PRC1 in human cells.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16431929 2006 KIF14 and citron kinase act together to promote efficient cytokinesis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15625105 2005 Cell cycle-dependent translocation of PRC1 on the spindle by Kif4 is essential for midzone formation and cytokinesis.
15616196 2005 Ablation of PRC1 by small interfering RNA demonstrates that cytokinetic abscission requires a central spindle bundle in mammalian cells, whereas completion of furrowing does not.
15531928 2004 Identification of PRC1 as the p53 target gene uncovers a novel function of p53 in the regulation of cytokinesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15297875 2004 Essential roles of KIF4 and its binding partner PRC1 in organized central spindle midzone formation.
14744859 2004 Human mitotic spindle-associated protein PRC1 inhibits MgcRacGAP activity toward Cdc42 during the metaphase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12889596 2003 Molecular characterization of oncostatin M-induced growth arrest of MCF-7 cells expressing a temperature-sensitive mutant of p53.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082078 2002 PRC1 is a microtubule binding and bundling protein essential to maintain the mitotic spindle midzone.
9885575 1998 PRC1: a human mitotic spindle-associated CDK substrate protein required for cytokinesis.