Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary


No data available

 Compartment GO Term (1)

 HCA RNA Cell Line (1)

AA Sequence

LRHPKRILFGTDYCPDCGNRSFYDLEADQYCC                                          351 - 382

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.