Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 2.0e-61
psoriasis 6685 9.3e-04
diabetes mellitus 1663 1.1e-03

AA Sequence

MSLQAPPRLLELAEQSLLRDRALAIPTLEELPRELFPPLFMEAFTRRCCETLTTMVQAWPFTCLPLGSLM      1 - 70
KSCNLEIFRAVLEGLDALLAQKVRPRRWKLQVLDLRNVDENFWGIWSGASALSPEALSKRRTAGNCPRPG     71 - 140
GQQPLMVILDLCFKNGTLDECLTHFLEWGKQRKGLLHVCCKELQIFGIAIHRIIEVLNTVELDCIQEVEV    141 - 210
CCPWELSILIRFAPYLGQMRNLRKLVLFNIHVSACIPLDRKEQFVIQFTSQFLKLDYFQKLYMHSVSFLE    211 - 280
GHLDQLLRCLQAPLETVVMTECLLSESDLKHLSWCPSIRQLKELDLRGITLTHFSPEPLSVLLEQAEATL    281 - 350
QTLDLEDCGIVDSQLSAILPALSRCSQLSTFSFCGNLISMAALENLLRHTVGLSKLSLELYPAPLESYDA    351 - 420
QGALCWGRFSQLGAELMKTLRDLRQPKIIVFSTVPCPRCGIRASYDLEPSHCLLNACCQGGFI           421 - 483
//

Text Mined References (1)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.