Property Summary

NCBI Gene PubMed Count 69
PubMed Score 194.00
PubTator Score 138.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 7.000 1.3e-09
sonic hedgehog group medulloblastoma 2.500 1.1e-03
atypical teratoid / rhabdoid tumor 3.600 1.7e-05
medulloblastoma, large-cell 4.700 1.2e-06
non-small cell lung cancer 2.577 1.0e-11
lung cancer 2.200 6.4e-05
lung adenocarcinoma 1.700 4.3e-03
Breast cancer 2.300 7.3e-03
ovarian cancer 2.200 3.2e-04
psoriasis 1.700 4.3e-13
facioscapulohumeral dystrophy 2.200 1.4e-02

Gene RIF (56)

PMID Text
26823776 Our results suggest that the leukemias expressing high levels of PRAME has favorable prognosis
26044287 PRAME expression is considered as a poor prognostic parameter in HL.
25887863 PRAME immunoreactivity in myeloid leukemia (ML) of Down syndrome (DS) is largely due to the non-blast components, while PRAME immunoreactivity in blasts of Transient abnormal myelopoiesis (TAM) is not restricted to cases that progress to ML of DS.
24820636 This study shows the prognostic significance of PRAME expression in diffuse large B-cell lymphoma patients treated with R-CHOP therapy.
24600975 results suggested that PRAME was a predictor for better outcome, could be a useful target for immunotherapy, and might represent a candidate marker for the monitoring of minimal residual disease
23905893 elevated PRAME expression in head and neck squamous cell carcinoma
23460923 PRAME is upregulated by signalling pathways that are activated in response to infection/inflammation.
23460923 PRAME and its paralogs are leucine rich repeat proteins. Structure predictions suggest PRAME resembles the extracellular domains of TLR3 and TLR4, or intracellular NALP family. This suggests PRAME may have a role in sensing Pathogen Associated Molecular Patterns (PAMPs).
23460923 PRAME expression in leukaemic cell lines is upregulated by IFN gamma and LPS, suggesting a possible role in immune responses. PRAME associates with Elongin BC complexes by binding Elongin C, and co-localises to the Golgi network. Nuclear PRAME interacts with Histone H3. The results suggest that PRAME has dual roles in gene regulation in the nucleus and protein turnover trafficking in the Golgi
23444226 PRAME impairs differentiation and increases proliferation likely via blocking retinoic acid receptor signaling.
23409080 Knock-down of PRAME increases retinoic acid signaling and cytotoxic drug sensitivity of Hodgkin lymphoma cells.
23228130 The complex PRAME/EZH2 is able to repress TRAIL expression, in a cancer-specific manner; inhibition of PRAME/EZH2 releases apoptosis-mediating TRAIL. (Review)
23110703 PRAME and WT1 transcripts constitute a good molecular marker combination for monitoring minimal residual disease in MDS.
23075240 PRAME as biomarkers for solid tumor
22912744 a novel link between the oncoprotein PRAME and the conserved EKC complex
22503131 PRAME expression is regulated at the epigenetic level. For this reason inhibitors of DNA methylation, such as 5-azacytidine, can modulate the expression of this tumor associated antigen.
22390931 these results suggest that PRAME plays an important role in cell proliferation and disease progression in osteosarcoma.
22384167 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine
22261449 PRAME effectively differentiates mullerian carcinoma from malignant mesothelioma at the mRNA and protein levels.
21928126 Studies suggest that activated human gammadelta T cells can efficiently present PRAME and STEAP1-derived epitopes and allow breaking tolerance against these tumor-associated self-antigens.
21822215 The authors applied protein-complex purification strategies and identified PRAME as a substrate recognition subunit of a Cullin2-based E3 ubiquitin ligase.
21691740 PRAME expression might be related to distinct patterns of tumorigenesis
21550659 PRAME plays an important role in disease progression in acute leukemia.
21347312 the expansion of the PRAME family occurred in both autosomes and sex chromosomes
21278353 The cytotoxic activity of our PRAME-specific CTLs was directed not only against leukemic blasts, but also against leukemic progenitor cells as assessed by colony-forming-inhibition assays, which have been implicated in leukemia relapse.
20838376 PRAME may be involved in the tumorigenic process in a wide range of cancers, at least in part by blocking the tumor suppressor pathway mediated by TRAIL expression.
20805128 Results showed the expression of MCSP and PRAME in conjunctival melanoma and benign conjunctival nevi and showed that MCSP and PRAME were differentially expressed in both and can help to differentiate the lesions diagnostically.
20723287 The level of prame gene transcript increases in chronic myeloid leukemia which associates with disease progression.
20376794 The PRAME transcript was highly expressed in acute myeloid leukemia patients and was a favorable marker of prognosis.
19625708 PRAME inhibits myeloid differentiation in certain myeloid leukemias, and that its function in these cells is lineage and phenotype dependent.
19474511 PRAME expression in DLBCL correlates with response to anthracycline containing chemotherapy.
19473719 E2F4, PHACTR3, PRAME family member and CDH12 most probably play important role in non-small-cell lung cancer geneses
19035174 PRAME mRNA could be used to monitor minimal residual disease in newly diagnosed acute myeloid leukemia patients.
19027161 Quantitative real-time PCR revealed that ZNF280A, ZNF280B, and PRAME mRNA expression was significantly lower in the 22q11 deletion cases compared to non-deleted cases
18988867 These results provide evidence for spontaneous T cell reactivity against multiple epitopes of PRAME in lymphoblastic leukemia, acute myeloid leukemia, and chronic myeloid leukemia
18950857 quantified both WT1 and PRAME transcript levels in the bone marrow of AML patients. Dynamic patterns of WT1 and PRAME during follow-up showed that a consistent elevation or a rise over time to exceed the normal range predicted clinical relapse
18815192 Low PRAME expression defines a subgroup of patients with acute promyelocytic leukemia with a short relapse-free survival
18709641 the 4 biomarkers CLU, ITGB3, PRAME and CAPG may be used as prognostic factors for patients with stage III serous ovarian adenocarcinomas.
18648365 Multivariable analysis indicated that PRAME is an independent marker of shortened metastasis-free interval in patients who did not receive adjuvant chemotherapy. PRAME expression was associated with tumour grade and negative oestrogen receptor status
18587578 The significant inverse correlation between the degree of methylation and PRAME expression suggests a causal role of DNA methylation in PRAME regulation.
18452107 Loss of PRAME is associated with childhood acute myeloid leukemia.
18295331 We conclude that HCL and CLL differ in PRAME overexpression, and that basal normal expression of PRAME may limit its usefulness for following patients with minimal residual CLL or HCL.
18088461 PRAME gene was overexpressed in adult acute leukemia patients and leukemia cell-lines.
18088454 PRAME expression in acute leukemia may be a useful marker to detect the minimal residual disease and to determine the response to therapy in acute leukemia patients.
17693191 PRAME expression is not associated with down-regulation of retinoic acid signaling in primary acute myeloid leukemia.
17624586 PRAME mRNA expression may be a useful prognostic and predictive marker for breast cancer.
17534929 Changes in the methylation pattern in defined parts of the regulatory regions of PRAME are sufficient for its upregulation in cells usually not expressing the gene.
17382387 hypomethylation of PRAME up-regulates its expression in CML and might play a significant role in the progression of the disease
16914202 PRAME is detected in one third of the cases with CLs. PRAME mRNA changes may be detected during the progression of these disorders and/or after therapy. PRAME mRNA may be a useful marker to detect the minimal residual disease and the response to therapy.
16860864 Overexpression of PRAME was associated with childhood acute leukemia
16681423 PRAME is expressed in acute myeloblastic leukaemia
16620968 The results suggest that the analysis of PRAME protein may contribute for the distinction between normal and leukemic cells in chronic lymphoproliferative disorders(CLD), and that PRAME may be a potential target for therapy.
16179254 The overexpression of PRAME protein frequently observed in human cancers confers growth or survival advantages by antagonizing retinoic acid receptor(RAR) signaling.
15240516 PRAME is highly expressed in primary advanced neuroblastoma
12419593 PRAME gene expression in childhood acute lymphoblastic leukemia
11943337 expression of PRAME is an indicator of favorable prognosis and could be a useful tool for monitoring minimal residual disease in childhood AML.

AA Sequence

MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLK      1 - 70
AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNR     71 - 140
ASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCC    141 - 210
KKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEK    211 - 280
EEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ    281 - 350
LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI    351 - 420
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHC    421 - 490
GDRTFYDPEPILCPCFMPN                                                       491 - 509
//

Text Mined References (72)

PMID Year Title
26823776 2015 PRAME induces apoptosis and inhibits proliferation of leukemic cells in vitro and in vivo.
26044287 2015 PRAME Expression and Its Clinical Relevance in Hodgkin's Lymphoma.
25887863 2015 PRAME immunohistochemical staining in transient abnormal myelopoiesis and myeloid leukemia associated with Down syndrome.
24820636 2014 Prognostic significance of PRAME expression based on immunohistochemistry for diffuse large B-cell lymphoma patients treated with R-CHOP therapy.
24600975 2014 PRAME gene expression in childhood acute lymphoblastic leukemia: impact on prognosis.
23905893 2013 Elevated PRAME expression: what does this mean for treatment of head and neck squamous cell carcinoma?
23460923 2013 PRAME is a golgi-targeted protein that associates with the Elongin BC complex and is upregulated by interferon-gamma and bacterial PAMPs.
23444226 2013 PRAME-induced inhibition of retinoic acid receptor signaling-mediated differentiation--a possible target for ATRA response in AML without t(15;17).
23409080 2013 Knock-down of PRAME increases retinoic acid signaling and cytotoxic drug sensitivity of Hodgkin lymphoma cells.
23228130 2013 PRAME/EZH2-mediated regulation of TRAIL: a new target for cancer therapy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23110703 2013 PRAME and WT1 transcripts constitute a good molecular marker combination for monitoring minimal residual disease in myelodysplastic syndromes.
23075240 2012 The cancer testis antigen PRAME as a biomarker for solid tumor cancer management.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
22503131 2012 Epigenetic regulation of PRAME in acute myeloid leukemia is different compared to CD34+ cells from healthy donors: effect of 5-AZA treatment.
22419371 2012 Hodgkin's lymphoma RNA-transfected dendritic cells induce cancer/testis antigen-specific immune responses.
22390931 2012 Expression and prognostic relevance of PRAME in primary osteosarcoma.
22384167 2012 NYESO-1/LAGE-1s and PRAME are targets for antigen specific T cells in chondrosarcoma following treatment with 5-Aza-2-deoxycitabine.
22261449 2012 PRAME (preferentially expressed antigen of melanoma) is a novel marker for differentiating serous carcinoma from malignant mesothelioma.
21928126 2012 Activated human ?? T cells induce peptide-specific CD8+ T-cell responses to tumor-associated self-antigens.
21822215 2011 The tumour antigen PRAME is a subunit of a Cul2 ubiquitin ligase and associates with active NFY promoters.
21691740 2011 Insights on PRAME and osteosarcoma by means of gene expression profiling.
21550659 2011 Inhibition of PRAME expression causes cell cycle arrest and apoptosis in leukemic cells.
21347312 2011 The expansion of the PRAME gene family in Eutheria.
21278353 2011 High-avidity cytotoxic T lymphocytes specific for a new PRAME-derived peptide can target leukemic and leukemic-precursor cells.
21269460 2011 Initial characterization of the human central proteome.
20838376 2011 BCR-ABL-mediated upregulation of PRAME is responsible for knocking down TRAIL in CML patients.
20805128 2010 Expression of MCSP and PRAME in conjunctival melanoma.
20723287 2010 [Quantification of prame gene transcript in chronic myeloid leukemia].
20376794 2010 [Quantification of the PRAME transcripts in patients with acute myeloid leukemia].
19625708 2009 The preferentially expressed antigen in melanoma (PRAME) inhibits myeloid differentiation in normal hematopoietic and leukemic progenitor cells.
19474511 2009 Oncogene associated cDNA microarray analysis shows PRAME gene expression is a marker for response to anthracycline containing chemotherapy in patients with diffuse large B-cell lymphoma.
19473719 2010 Identification of genes associated with non-small-cell lung cancer promotion and progression.
19035174 2008 [PRAME mRNA expression in newly diagnosed acute myeloid leukemia patients and its application to monitoring minimal residual disease].
19027161 2009 Array CGH analysis of chronic lymphocytic leukemia reveals frequent cryptic monoallelic and biallelic deletions of chromosome 22q11 that include the PRAME gene.
18988867 2009 Ex vivo characterization of polyclonal memory CD8+ T-cell responses to PRAME-specific peptides in patients with acute lymphoblastic leukemia and acute and chronic myeloid leukemia.
18950857 2009 Expression patterns of WT1 and PRAME in acute myeloid leukemia patients and their usefulness for monitoring minimal residual disease.
18815192 2008 The relevance of preferentially expressed antigen of melanoma (PRAME) as a marker of disease activity and prognosis in acute promyelocytic leukemia.
18709641 2008 Four potential biomarkers as prognostic factors in stage III serous ovarian adenocarcinomas.
18648365 2008 PRAME expression and clinical outcome of breast cancer.
18587578 2008 Aberrant hypomethylation of the cancer-testis antigen PRAME correlates with PRAME expression in acute myeloid leukemia.
18452107 2008 Tumor associated antigen PRAME is a marker of favorable prognosis in childhood acute myeloid leukemia patients and modifies the expression of S100A4, Hsp 27, p21, IL-8 and IGFBP-2 in vitro and in vivo.
18295331 2008 PRAME expression in hairy cell leukemia.
18088461 2007 [Expression of PRAME gene in adult acute leukemia and its significance in prognosis].
18088454 2007 [Expression of PRAME gene in acute leukemia and its clinical significance].
17693191 2007 PRAME expression is not associated with down-regulation of retinoic acid signaling in primary acute myeloid leukemia.
17624586 2008 Prevalence and prognostic and predictive relevance of PRAME in breast cancer.
17534929 2007 Hypomethylation of PRAME is responsible for its aberrant overexpression in human malignancies.
17382387 2007 Epigenetic regulation of PRAME gene in chronic myeloid leukemia.
16914202 2007 PRAME mRNA levels in cases with chronic leukemia: Clinical importance and review of the literature.
16860864 2007 Quantitative assessment of PRAME expression in diagnosis of childhood acute leukemia.
16681423 2006 Real-time RT-PCR quantification of PRAME gene expression for monitoring minimal residual disease in acute myeloblastic leukaemia.
16620968 2006 PRAME is a membrane and cytoplasmic protein aberrantly expressed in chronic lymphocytic leukemia and mantle cell lymphoma.
16179254 2005 The human tumor antigen PRAME is a dominant repressor of retinoic acid receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15240516 2004 The tumor-associated antigen PRAME is universally expressed in high-stage neuroblastoma and associated with poor outcome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12688312 2003 Preferentially expressed antigen of melanoma (PRAME) in the development of diagnostic and therapeutic methods for hematological malignancies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12419593 2002 PRAME gene expression in childhood acute lymphoblastic leukemia.
11298586 2001 Quantitative monitoring of the PRAME gene for the detection of minimal residual disease in leukaemia.
10741395 2000 The cancer germ-line genes MAGE-1, MAGE-3 and PRAME are commonly expressed by human myeloma cells.
10682862 2000 Identification of a melanoma antigen, PRAME, as a BCR/ABL-inducible gene.
10591208 1999 The DNA sequence of human chromosome 22.
9753074 1998 PRAME, a gene encoding an antigen recognized on a human melanoma by cytolytic T cells, is expressed in acute leukaemia cells.
9751617 1998 Heterogeneous expression of the tumor-associated antigens RAGE-1, PRAME, and glycoprotein 75 in human renal cell carcinoma: candidates for T-cell-based immunotherapies?
9619397 1998 The immunogenic properties of melanoma-associated antigens recognized by cytotoxic T lymphocytes.
9466265 1998 Using the yeast two-hybrid system to identify human epithelial cell proteins that bind gonococcal Opa proteins: intracellular gonococci bind pyruvate kinase via their Opa proteins and require host pyruvate for growth.
9047241 1997 Characterization of an antigen that is recognized on a melanoma showing partial HLA loss by CTL expressing an NK inhibitory receptor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.