1. Home
  2. Targets
  3. transporter
  4. amino acid transporter
  5. PRA1 family protein 2

Tbio PRA1 family protein 2

May be involved in ER/Golgi transport and vesicular traffic. Plays a proapoptic role in cerulenin-induced neuroblastoma apoptosis.

 Comments

Property Summary

NCBI Gene PubMed Count 11
PubMed Score 15.48
PubTator Score 9.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 8.0e-05
group 3 medulloblastoma 2254 3.5e-03
Disease Target Count Z-score Confidence
Neuroblastoma 78 3.281 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.200 3.5e-03
ovarian cancer 1.100 8.0e-05

Synonym

Accession O60831 B2RD20
Symbols JM4
Yip6a

Gene

PRAF2

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

 UniProt Keyword (9)

 GO Component (2)

 GO Process (2)

 Compartment GO Term (29)

See all...

 IMPC Phenotype (2)

 MGI Phenotype (1)

 HCA RNA Cell Line (56)

See all...

Pathway (2)

Gene RIF (7)

PMID Text
23440329 PRAF2 plays an essential role in neuroblastoma tumorigenesis and metastasis.
21203533 Praf2 is a novel Bcl-xL/Bcl-2 interacting protein with the ability to modulate survival of cancer cells
20412121 PRAF2 expression is elevated in various tumors with exceptionally high expression in malignant gliomas, and may thus presents a candidate molecular target for therapeutic intervention.
18395978 The expression of PRAF2 in specific regions of the brain including SVs suggest an important physiological function for this novel protein, possibly by participating in multiple aspects of SV maturation, transport, and signal transmission.
17975142 PRAF2 has a role in progression of neuroblastoma
16481131 CCR5-interacting PRAF2 protein is expressed in several human tissues with a possible function in ER/Golgi transport and vesicular traffic.
15757671 PRAF2 (JM4) is CCR5-interacting protein, which is suggested to function in trafficking and membrane localisation of the receptor.

AA Sequence 

MSEVRLPPLRALDDFVLGSARLAAPDPCDPQRWCHRVINNLLYYQTNYLLCFGIGLALAGYVRPLHTLLS      1 - 70
ALVVAVALGVLVWAAETRAAVRRCRRSHPAACLAAVLAVGLLVLWVAGGACTFLFSIAGPVLLILVHASL     71 - 140
RLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS                                    141 - 178
//

Text Mined References (13)

PMID Year Title
23440329 2013 PRAF2 stimulates cell proliferation and migration and predicts poor prognosis in neuroblastoma.
21269460 2011 Initial characterization of the human central proteome.
21203533 2010 Praf2 is a novel Bcl-xL/Bcl-2 interacting protein with the ability to modulate survival of cancer cells.
20412121 2010 Subcellular distribution and expression of prenylated Rab acceptor 1 domain family, member 2 (PRAF2) in malignant glioma: Influence on cell survival and migration.
18395978 2008 Expression profile of PRAF2 in the human brain and enrichment in synaptic vesicles.
17975142 2007 Expression of prenylated Rab acceptor 1 domain family, member 2 (PRAF2) in neuroblastoma: correlation with clinical features, cellular localization, and cerulenin-mediated apoptosis regulation.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16481131 2006 Genomic organization, expression profile, and characterization of the new protein PRA1 domain family, member 2 (PRAF2).
16472945 2006 Genomic organization, characterization, and molecular 3D model of GDE1, a novel mammalian glycerophosphoinositol phosphodiesterase.
15757671 2005 JM4 is a four-transmembrane protein binding to the CCR5 receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.