Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.49
PubTator Score 2.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 4.6e-04
Disease Target Count Z-score Confidence
Pyelonephritis 13 4.128 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.150 4.6e-04

Synonym

Accession Q9BSG0 Q2Z1P2
Symbols PAP21
C2orf7

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEP      1 - 70
PEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIP     71 - 140
ALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW                          141 - 188
//

Text Mined References (8)

PMID Year Title