Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.0e-07

Gene RIF (1)

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPG      1 - 70
RWKPVAPRTMKACPQVLLEW                                                       71 - 90
//

Text Mined References (2)

PMID Year Title