Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.17
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.200 1.9e-04
osteosarcoma -2.120 4.9e-07
ovarian cancer 1.200 2.5e-04
pancreatic ductal adenocarcinoma liver m... -1.630 9.0e-03

AA Sequence

MEAEGLDWLLVPLHQLVSWGAAAAMVFGGVVPYVPQYRDIRRTQNADGFSTYVCLVLLVANILRILFWFG      1 - 70
RRFESPLLWQSAIMILTMLLMLKLCTEVRVANELNARRRSFTAADSKDEEVKVAPRRSFLDFDPHHFWQW     71 - 140
SSFSDYVQCVLAFTGVAGYITYLSIDSALFVETLGFLAVLTEAMLGVPQLYRNHRHQSTEGMSIKMVLMW    141 - 210
TSGDAFKTAYFLLKGAPLQFSVCGLLQVLVDLAILGQAYAFARHPQKPAPHAVHPTGTKAL             211 - 271
//

Text Mined References (7)

PMID Year Title