Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.09
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
osteosarcoma 2.074 8.8e-06
ependymoma -1.300 4.2e-08
group 4 medulloblastoma -1.400 1.5e-04
atypical teratoid/rhabdoid tumor -1.700 1.4e-08
medulloblastoma, large-cell -1.200 2.8e-04
primary pancreatic ductal adenocarcinoma 1.683 9.0e-04
adult high grade glioma -1.400 2.1e-06
spina bifida -1.041 4.1e-02
Pick disease 1.200 2.2e-04
Breast cancer -1.200 5.9e-19
acute myeloid leukemia 1.300 6.4e-03
ovarian cancer 1.700 4.3e-03
pancreatic cancer 1.500 3.5e-03

Synonym

Accession Q8NI37 B3KWC5 Q68DZ7 Q6UY82
Symbols TAPP2C
TA-PP2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
15177553 Microarray evidence for coexpression of TA-PP2C with IL2 in T-cells and other cell types.

AA Sequence

MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRS      1 - 70
ADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTAC     71 - 140
IVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSF    141 - 210
DVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDN    211 - 280
GLNVRGGKPDDITVLLSIVAEYTD                                                  281 - 304
//

Text Mined References (6)

PMID Year Title
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15177553 2004 T lymphocyte activation gene identification by coregulated expression on DNA microarrays.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.