Property Summary

NCBI Gene PubMed Count 35
PubMed Score 71.09
PubTator Score 31.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 2.081 9.1e-04
osteosarcoma 1.453 2.4e-05
atypical teratoid / rhabdoid tumor -1.300 9.6e-05
glioblastoma -1.100 9.5e-03
medulloblastoma, large-cell -1.400 3.5e-05
pancreatic ductal adenocarcinoma liver m... -1.077 3.1e-02
invasive ductal carcinoma -1.500 1.1e-02
ovarian cancer -2.600 2.1e-09
dermatomyositis -1.300 2.1e-03

Gene RIF (21)

PMID Text
27026398 findings suggest that BRCA1 is a novel modulator of PP6 signalling via its interaction with ANKRD28.
26462736 Data show 408 phosphopeptides on 272 proteins that increased and 298 phosphopeptides on 220 proteins that decreased in phosphorylation upon catalytic subunit of rotein phosphatase 6 (PP6c) depletion in mitotic cells.
26138368 Protein phosphatase 6 (ppp6c), a negative regulator that restricts the G1 to S phase progression, is diminished in human psoriatic epidermis and is directly targeted by miR-31.
25999147 PP6 is involved in a diverse set of biological pathways.
25187537 These results suggest that human PP6 interacts with and positively regulates the activity of the influenza A virus RNA-dependent RNA polymerase.
24336958 PP6C mutations have distinct functional and clinical consequences in melanoma, and confer sensitivity to Aurora A kinase inhibitors.
24064353 PP2A holoenzyme and PP6 were found stably associated with U1 snRNP; findings indicate that these phosphatases regulate splicing catalysis involving U1 snRNP and suggest an important evolutionary conserved role of PP2A family phosphatases in pre-mRNA splicing
24063632 PP6c associates with E-cadherin in adherens junctions and is required to oppose casein kinase-1 to maintain cell surface localization of E-cadherin.
23864707 Results show that Sit4p and its mammalian orthologue, PP6, regulate traffic from the ER to the Golgi complex which is consistent with its role in coat recycling.
23729733 Findings support the view that formation of micronuclei rather than chromosome instability alone explains how loss of PPP6C, and more generally mitotic spindle and centrosome defects, can act as drivers for genome instability in melanoma.
22174317 HIV-1 Rev interacting protein, protein phosphatase 6, catalytic subunit (PPP6C), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
21481188 miR-373 can regulate cell cycle progression by targeting PPP6C transcripts and promotes the growth activity of HCC cells in vitro. The downregulation of PPP6C by miR-373 may explain why the expression of miR-373 can promote HCC cell proliferation.
21451261 PP6 is required for non-homologous end joining repair; its expression may harbor a protective role during the development of breast cancer tissues.
21187329 Results demonstrate a role for PP6 as the T-loop phosphatase regulating Aurora A activity bound to its activator TPX2 during mitotic spindle formation.
20065038 A novel function of DNA-PKcs is to recruit PP6 to sites of DNA damage and that PP6 contributes to the dephosphorylation of gamma-H2AX, the dissolution of ionizing radiation-induced foci, and release from the G(2)/M checkpoint in vivo.
19626039 our results seem to discard the role of the previously described polymorphisms in SERPINE2, PPP6C and PBX3 in celiac disease susceptibility.
19626039 Observational study of gene-disease association. (HuGE Navigator)
19621075 results illustrate that the human PP6-associated proteins are capable of providing distinct rapamycin-sensitive and Sit4-dependent Sap functions in the heterologous context of the yeast cell
19198648 Our data demonstrate that protein phosphatase-6 associates with and activates DNA-PK in response to ionizing radiation.
17568194 PP6 regulates cell cycle progression in human cells at least in part through control of cyclin D1 and the function of PP6 is distinct from its homolog Sit4 in yeast.
16769727 Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon

AA Sequence

MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQ      1 - 70
VPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWR     71 - 140
YCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPEDVDTWAISPR    141 - 210
GAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR    211 - 280
EPKLFRAVPDSERVIPPRTTTPYFL                                                 281 - 305
//

Text Mined References (41)

PMID Year Title
27026398 2016 BRCA1 affects protein phosphatase 6 signalling through its interaction with ANKRD28.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26462736 2015 Quantitative phosphoproteomics reveals new roles for the protein phosphatase PP6 in mitotic cells.
26138368 2015 NF-?B-induced microRNA-31 promotes epidermal hyperplasia by repressing protein phosphatase 6 in psoriasis.
25999147 2015 Adaptation of HepG2 cells to a steady-state reduction in the content of protein phosphatase 6 (PP6) catalytic subunit.
25187537 2014 Interactome analysis of the influenza A virus transcription/replication machinery identifies protein phosphatase 6 as a cellular factor required for efficient virus replication.
24336958 2014 PP6C hotspot mutations in melanoma display sensitivity to Aurora kinase inhibition.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24064353 2013 Protein phosphatase 2A family members (PP2A and PP6) associate with U1 snRNP and the spliceosome during pre-mRNA splicing.
24063632 2013 Protein Ser/Thr phosphatase-6 is required for maintenance of E-cadherin at adherens junctions.
23864707 2013 Sit4p/PP6 regulates ER-to-Golgi traffic by controlling the dephosphorylation of COPII coat subunits.
23729733 2013 Melanoma-associated mutations in protein phosphatase 6 cause chromosome instability and DNA damage owing to dysregulated Aurora-A.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22715043 2012 A PP6-type phosphatase holoenzyme directly regulates PIN phosphorylation and auxin efflux in Arabidopsis.
21481188 2011 MicroRNA-373, a new regulator of protein phosphatase 6, functions as an oncogene in hepatocellular carcinoma.
21451261 2011 Protein phosphatase PP6 is required for homology-directed repair of DNA double-strand breaks.
21269460 2011 Initial characterization of the human central proteome.
21187329 2010 Protein phosphatase 6 regulates mitotic spindle formation by controlling the T-loop phosphorylation state of Aurora A bound to its activator TPX2.
20065038 2010 Protein phosphatase 6 interacts with the DNA-dependent protein kinase catalytic subunit and dephosphorylates gamma-H2AX.
19626039 2009 Lack of replication of celiac disease risk variants reported in a Spanish population using an independent Spanish sample.
19621075 2009 Human protein phosphatase PP6 regulatory subunits provide Sit4-dependent and rapamycin-sensitive sap function in Saccharomyces cerevisiae.
19198648 2009 Activation of DNA-PK by ionizing radiation is mediated by protein phosphatase 6.
18186651 2008 Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains.
17568194 2007 Protein phosphatase PP6 N terminal domain restricts G1 to S phase progression in human cancer cells.
17384681 2007 Identification of a PP2A-interacting protein that functions as a negative regulator of phosphatase activity in the ATM/ATR signaling pathway.
17079228 2006 Protein phosphatase 6 down-regulates TAK1 kinase activation in the IL-1 signaling pathway.
16769727 2006 Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16276083 2006 Inconsistencies between human genetic cytolocations and those derived using genomic sequence.
16085932 2005 A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10227379 1999 Identification of a type 6 protein ser/thr phosphatase regulated by interleukin-2 stimulation.
9647778 1998 Alpha 4 associates with protein phosphatases 2A, 4, and 6.
9143513 1997 Localization of the novel serine/threonine protein phosphatase 6 gene (PPP6C) to human chromosome Xq22.3.
9013334 1996 The novel human protein serine/threonine phosphatase 6 is a functional homologue of budding yeast Sit4p and fission yeast ppe1, which are involved in cell cycle regulation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.