Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 9.1e-03
atypical teratoid / rhabdoid tumor -1.500 2.6e-05
ependymoma -2.400 7.5e-03
glioblastoma -1.600 4.7e-03
medulloblastoma -1.200 5.1e-03
medulloblastoma, large-cell -1.700 1.6e-05
oligodendroglioma -2.400 3.4e-03
osteosarcoma -3.478 1.5e-11
ovarian cancer -2.000 3.1e-08
pituitary cancer 1.200 1.1e-03

AA Sequence

MAEMRAWRPLVRPSLQCVKLGRATARWWWVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVV      1 - 70
DSLDIESMTIEGEYSGPKLEDDKVTITFMKGLMQWYKDQKKLHQKCAYQGLALSPRLKCSGTITAHCSLN     71 - 140
LLGPRDPPTSASQVAVTEGMHHHTWLIFLFL                                           141 - 171
//

Text Mined References (4)

PMID Year Title