Property Summary

NCBI Gene PubMed Count 65
PubMed Score 41.94
PubTator Score 109.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 1.3e-03
malignant mesothelioma 1.300 2.9e-05
osteosarcoma 1.332 4.8e-04
subependymal giant cell astrocytoma -1.117 1.7e-02

Gene RIF (32)

AA Sequence

MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSL      1 - 70
AYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECN     71 - 140
KIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY    141 - 210
QILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSV    211 - 280
EVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLI    281 - 350
MHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL    351 - 420
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA    421 - 490
NTLLQLGMM                                                                 491 - 499
//

Text Mined References (74)

PMID Year Title