Property Summary

NCBI Gene PubMed Count 60
PubMed Score 52.05
PubTator Score 109.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 2.9e-05
osteosarcoma 1.332 4.8e-04
lung cancer 1.300 1.3e-03
subependymal giant cell astrocytoma -1.117 1.7e-02

Protein-protein Interaction (10)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
463222 other 4 / 0 / 61 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5
463223 other 4 / 0 / 60 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5
463224 confirmatory 2 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5
624425 confirmatory 7 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5)
624432 confirmatory 0 / 0 / 2 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (12.7 nM low dose)
624433 confirmatory 4 / 0 / 3 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (3.8nM low dose)
624434 other 14 / 0 / 11 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5)
624435 other 6 / 0 / 30 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5 (Round 5)
624439 confirmatory 5 / 0 / 3 Late stage assay provider counterscreen for the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP5 (Round 5)
624448 confirmatory 0 / 0 / 8 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: fluorescence-based biochemical dose response assay to determine activity of inhibitors on dephosphorylation of OMFP by PP5 (Round 5) (1uM low dose)

Gene RIF (30)

PMID Text
26157124 Measles Virus Infection Inactivates Cellular Protein Phosphatase 5 with Consequent Suppression of Sp1 and c-Myc Activities.
25796168 PPP5C could be essential for glioma cell growth.
25326185 We demonstrate for the first time that PPP5C is essential for growth of HCC cells, which suggests that inhibition of PPP5C by RNAi may be a potential therapeutic strategy for the treatment of hepatocellular carcinoma.
25322973 the importance of PP5 in CRC cell growth
25269953 Data indicate that Cu-oxidized S100 calcium binding protein A4 (S100A4) interacted with S100 calcium binding protein A1 (S100A1) and prevented protein phosphatase 5 (PP5) activation.
24327656 These results demonstrate that Hsp70 recruits PP5 and activates its phosphatase activity which suggests dual roles for PP5 that might link chaperone systems with signaling pathways in cancer and development.
23352616 these results suggest that caveolin-1 is a novel physiological activator of PP5.
23184943 Chp-1 and melusin can interact with cochaperones PP5 and Sgt1 and with each other in an ATP-dependent manner
23102700 Suggest that Slim/KLHDC10 is an activator of ASK1, contributing to oxidative stress-induced cell death through the suppression of PP5.
22592921 proasthmatic cytokine-induced corticosteroid insensitivity in airway smooth muscle cells is due, in part, to PP5-mediated impairment of glucocorticoid receptor-Ser211 phosphorylation.
22399290 S100A1 and permanently active S100P inhibited the apoptosis signal-regulating kinase 1 (ASK1) and PP5 interaction, resulting the inhibition of dephosphorylation of phospho-ASK1 by PP5
21921034 genetic disruption of PP5 is associated with enhanced and prolonged phosphorylation of a single serine (Ser-345) on Chk1
21144835 PP5 plays a crucial role in ATR-mediated repair of UV-induced DNA damage.
20875921 Findings are indicative of a regulatory role of PP5 in cardiac function.
19948726 Specific binding of PP5 to activated Rac1 provides a direct mechanism by which PP5 can be stimulated and recruited to participate in Rac1-mediated signaling pathways.
19586900 Estrogen inhibits glucocorticoid action via protein phosphatase 5 (PP5)-mediated glucocorticoid receptor dephosphorylation.
19176521 PP5 plays an important role in the regulation of 53BP1 phosphorylation and activity in vivo
18547097 domain amphiphilicity is of higher importance than amino acid sequence specificity in the determination of protein adsorption and interfacial activity.
18280813 these studies indicate that elevated levels of PP5 protein occur in human breast cancer and suggest that PP5 over-expression may aid tumor progression.
17084641 Protein phosphatase 5 as a key dephosphorylation regulator of Raf-1 activation.
16892053 PP5 is a physiological regulator of Raf-1 signalling pathways.
16790549 PP5, casein kinase Iepsilon, and cryptochrome dynamically regulate the mammalian circadian clock
16531226 We report the solution structure of a complex of the TPR domain of Ppp5 with the C-terminal pentapeptide of Hsp90.This may be important for the relief of autoinhibition in Ppp5 and for the mechanisms of TPR-mediated recognition of Hsp90 by other proteins.
16260606 PP5 plays a critical role in ATR-mediated checkpoint activation
15577939 Results describe the structure of the autoinhibited state of protein phosphatase 5, revealing mechanisms of tetratricopeptide repeat-mediated phosphatase inhibition and Hsp90- and arachidonic acid-induced stimulation of phosphatase activity.
15328343 PP5 plays an important role in the survival of cells in a low oxygen environment by suppressing a hypoxia-induced ASK-1/MKK4/JNK signaling cascade that promotes an apoptotic response
15218033 PP5 is regulated by mTOR and activates apoptosis signal-regulating kinase 1 signaling
15155720 structure of Serine/threonine protein phosphatase-5(PP5c) provides a structural basis for explaining the exceptional catalytic proficiency of protein phosphatases.
14734805 protein phosphatase 5 interacts with DNA-PKcs and dephosphorylates with surprising specificity at least two functional sites.
12519780 PP5 suppresses a pathway regulating the expression of p21(waf1)

AA Sequence

MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSL      1 - 70
AYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKPHDKDAKMKYQECN     71 - 140
KIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPKLEDGKVTISFMKELMQWYKDQKKLHRKCAY    141 - 210
QILVQVKEVLSKLSTLVETTLKETEKITVCGDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSV    211 - 280
EVILTLFGFKLLYPDHFHLLRGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLI    281 - 350
MHGGLFSEDGVTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL    351 - 420
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVPHPNVKPMAYA    421 - 490
NTLLQLGMM                                                                 491 - 499
//

Text Mined References (69)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26157124 2015 Measles Virus Infection Inactivates Cellular Protein Phosphatase 5 with Consequent Suppression of Sp1 and c-Myc Activities.
25796168 2015 Serine/Threonine Protein Phosphatase-5 Accelerates Cell Growth and Migration in Human Glioma.
25326185 2015 Knockdown of PPP5C inhibits growth of hepatocellular carcinoma cells in vitro.
25322973 Inhibition of protein phosphatase 5 (PP5) suppresses survival and growth of colorectal cancer cells.
25269953 2014 Oxidized S100A4 inhibits the activation of protein phosphatase 5 through S100A1 in MKN?45 gastric carcinoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24327656 2014 The molecular chaperone Hsp70 activates protein phosphatase 5 (PP5) by binding the tetratricopeptide repeat (TPR) domain.
23352616 2013 Caveolin-1 interacts with protein phosphatase 5 and modulates its activity in prostate cancer cells.
23184943 2013 Dynamic nucleotide-dependent interactions of cysteine- and histidine-rich domain (CHORD)-containing Hsp90 cochaperones Chp-1 and melusin with cochaperones PP5 and Sgt1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
22781750 2012 Protein phosphatase 5 modulates SMAD3 function in the transforming growth factor-? pathway.
22592921 2012 Cytokines alter glucocorticoid receptor phosphorylation in airway cells: role of phosphatases.
22399290 2012 S100 proteins modulate protein phosphatase 5 function: a link between CA2+ signal transduction and protein dephosphorylation.
21921034 2011 Disruption of serine/threonine protein phosphatase 5 (PP5:PPP5c) in mice reveals a novel role for PP5 in the regulation of ultraviolet light-induced phosphorylation of serine/threonine protein kinase Chk1 (CHEK1).
21360678 2011 Label-free quantitative proteomics and SAINT analysis enable interactome mapping for the human Ser/Thr protein phosphatase 5.
21269460 2011 Initial characterization of the human central proteome.
21144835 2011 Protein phosphatase 5 is necessary for ATR-mediated DNA repair.
20875921 2012 Modulation of cardiac contractility by serine/threonine protein phosphatase type 5.
19948726 2010 Activated Rac1 GTPase translocates protein phosphatase 5 to the cell membrane and stimulates phosphatase activity in vitro.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19601647 2009 Structural basis of serine/threonine phosphatase inhibition by the archetypal small molecules cantharidin and norcantharidin.
19586900 2009 Estrogen inhibits glucocorticoid action via protein phosphatase 5 (PP5)-mediated glucocorticoid receptor dephosphorylation.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19176521 2009 Protein phosphatase 5 regulates the function of 53BP1 after neocarzinostatin-induced DNA damage.
18547097 2008 Characterization of the tetratricopeptide-containing domain of BUB1, BUBR1, and PP5 proves that domain amphiphilicity over amino acid sequence specificity governs protein adsorption and interfacial activity.
18280813 2008 Elevated levels of Ser/Thr protein phosphatase 5 (PP5) in human breast cancer.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17084641 2006 Protein phosphatase 5 as a negative key regulator of Raf-1 activation.
16892053 2006 Regulation of the Raf-MEK-ERK pathway by protein phosphatase 5.
16790549 2006 Posttranslational regulation of the mammalian circadian clock by cryptochrome and protein phosphatase 5.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16531226 2006 Conformational diversity in the TPR domain-mediated interaction of protein phosphatase 5 with Hsp90.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16260606 2005 Protein phosphatase 5 is required for ATR-mediated checkpoint activation.
15577939 2005 Molecular basis for TPR domain-mediated regulation of protein phosphatase 5.
15546861 2005 Dephosphorylation of tau by protein phosphatase 5: impairment in Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15383005 2005 Human protein phosphatase 5 dissociates from heat-shock proteins and is proteolytically activated in response to arachidonic acid and the microtubule-depolymerizing drug nocodazole.
15328343 2004 Ser/Thr protein phosphatase 5 inactivates hypoxia-induced activation of an apoptosis signal-regulating kinase 1/MKK-4/JNK signaling cascade.
15218033 2004 Inhibition of mammalian target of rapamycin activates apoptosis signal-regulating kinase 1 signaling by suppressing protein phosphatase 5 activity.
15155720 2004 Structural basis for the catalytic activity of human serine/threonine protein phosphatase-5.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14871926 2004 Requirement of protein phosphatase 5 in DNA-damage-induced ATM activation.
14764652 2004 Protein phosphatase 5 is a negative regulator of estrogen receptor-mediated transcription.
14734805 2004 DNA-PKcs function regulated specifically by protein phosphatase 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12522145 2003 Identification of targets for calcium signaling through the copine family of proteins. Characterization of a coiled-coil copine-binding motif.
12519780 2003 Identification of a functional link for the p53 tumor suppressor protein in dexamethasone-induced growth suppression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12176367 2002 Galpha(12) and Galpha(13) interact with Ser/Thr protein phosphatase type 5 and stimulate its phosphatase activity.
11689443 2001 Negative feedback regulation of ASK1 by protein phosphatase 5 (PP5) in response to oxidative stress.
11504734 2001 Interaction between protein phosphatase 5 and the A subunit of protein phosphatase 2A: evidence for a heterotrimeric form of protein phosphatase 5.
10400612 1999 Identification of conserved residues required for the binding of a tetratricopeptide repeat domain to heat shock protein 90.
9482716 1998 The structure of the tetratricopeptide repeats of protein phosphatase 5: implications for TPR-mediated protein-protein interactions.
9405394 1997 The serine/threonine phosphatase PP5 interacts with CDC16 and CDC27, two tetratricopeptide repeat-containing subunits of the anaphase-promoting complex.
9383998 1997 Human blue-light photoreceptor hCRY2 specifically interacts with protein serine/threonine phosphatase 5 and modulates its activity.
9195923 1997 Protein phosphatase 5 is a major component of glucocorticoid receptor.hsp90 complexes with properties of an FK506-binding immunophilin.
9000529 1997 Activation of protein phosphatase 5 by limited proteolysis or the binding of polyunsaturated fatty acids to the TPR domain.
8666404 1995 Cloning of a highly conserved human protein serine-threonine phosphatase gene from the glioma candidate region on chromosome 19q13.3.
8561788 1996 Chromosomal localization and 5' sequence of the human protein serine/threonine phosphatase 5' gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7925273 1994 A novel human protein serine/threonine phosphatase, which possesses four tetratricopeptide repeat motifs and localizes to the nucleus.
1330687 1992 p42 MAP kinase phosphorylation sites in microtubule-associated protein tau are dephosphorylated by protein phosphatase 2A1. Implications for Alzheimer's disease [corrected].