Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.88
PubTator Score 4.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -1.468 9.5e-04
glioblastoma -1.100 3.8e-05
acute quadriplegic myopathy 1.177 3.0e-04
pancreatic ductal adenocarcinoma liver m... -1.353 1.6e-02
pediatric high grade glioma 1.100 2.2e-04
atypical teratoid/rhabdoid tumor 1.100 1.7e-04
ovarian cancer -1.600 5.8e-04
pancreatic cancer 1.100 1.8e-02

Protein-protein Interaction (11)

Gene RIF (3)

PMID Text
22559936 PPP4R2 affects the survival of neuronal cells in response to DNA damage.
20154705 PP4R2, a regulatory subunit of PP4, mediates the DNA damage-dependent association between RPA2 and the PP4C catalytic subunit.
18614045 A three-protein PP4 phosphatase complex in mammalian cells, containing PP4C, PP4R2, and PP4R3beta, specifically dephosphorylates ATR-mediated gamma-H2AX generated during DNA replication.

AA Sequence

MDVERLQEALKDFEKRGKKEVCPVLDQFLCHVAKTGETMIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGP      1 - 70
PNPNVEYIPFDEMKERILKIVTGFNGIPFTIQRLCELLTDPRRNYTGTDKFLRGVEKNVMVVSCVYPSSE     71 - 140
KNNSNSLNRMNGVMFPGNSPSYTERSNINGPGTPRPLNRPKVSLSAPMTTNGLPESTDSKEANLQQNEEK    141 - 210
NHSDSSTSESEVSSVSPLKNKHPDEDAVEAEGHEVKRLRFDKEGEVRETASQTTSSEISSVMVGETEASS    211 - 280
SSQDKDKDSRCTRQHCTEEDEEEDEEEEEESFMTSREMIPERKNQEKESDDALTVNEETSEENNQMEESD    281 - 350
VSQAEKDLLHSEGSENEGPVSSSSSDCRETEELVGSNSSKTGEILSESSMENDDEATEVTDEPMEQD       351 - 417
//

Text Mined References (24)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26194823 2015 Dephosphorylation of DBC1 by Protein Phosphatase 4 Is Important for p53-Mediated Cellular Functions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22732494 2012 Protein phosphatase PP4 is involved in NHEJ-mediated repair of DNA double-strand breaks.
22559936 2012 PPP4R2 regulates neuronal cell differentiation and survival, functionally cooperating with SMN.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20154705 2010 A PP4 phosphatase complex dephosphorylates RPA2 to facilitate DNA repair via homologous recombination.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614045 2008 A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16085932 2005 A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12668731 2003 Protein phosphatase 4 interacts with the Survival of Motor Neurons complex and enhances the temporal localisation of snRNPs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10769191 2000 A novel 50 kDa protein forms complexes with protein phosphatase 4 and is located at centrosomal microtubule organizing centres.