Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.71
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.291 4.6e-03
posterior fossa group B ependymoma 1.700 6.3e-11
oligodendroglioma 1.300 2.8e-02
psoriasis 1.600 7.1e-05
group 3 medulloblastoma 1.500 1.5e-04
glioblastoma 1.500 2.0e-03
atypical teratoid/rhabdoid tumor 1.300 4.0e-08
primitive neuroectodermal tumor 1.300 1.6e-04
juvenile dermatomyositis 1.117 1.1e-12
ovarian cancer 2.200 1.5e-04

Synonym

Accession Q8TF05 Q99774 Q9UNQ7
Symbols MEG1
PP4R1
PP4(Rmeg)

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25134449 PP4R1 could mediate the dephosphorylation of TRAF2 Ser11.
23084358 PP4R1 expression was triggered upon activation and proliferation of primary human T lymphocytes and deficiency for PP4R1 caused sustained and increased IKK activity, T cell hyperactivation, and aberrant NF-kappaB signaling in NF-kappaB-addicted T cell lymphomas
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MADLSLLQEDLQEDADGFGVDDYSSESDVIIIPSALDFVSQDEMLTPLGRLDKYAASENIFNRQMVARSL      1 - 70
LDTLREVCDDERDCIAVLERISRLADDSEPTVRAELMEQVPHIALFCQENRPSIPYAFSKFLLPIVVRYL     71 - 140
ADQNNQVRKTSQAALLALLEQELIERFDVETKVCPVLIELTAPDSNDDVKTEAVAIMCKMAPMVGKDITE    141 - 210
RLILPRFCEMCCDCRMFHVRKVCAANFGDICSVVGQQATEEMLLPRFFQLCSDNVWGVRKACAECFMAVS    211 - 280
CATCQEIRRTKLSALFINLISDPSRWVRQAAFQSLGPFISTFANPSSSGQYFKEESKSSEEMSVENKNRT    281 - 350
RDQEAPEDVQVRPEDTPSDLSVSNSSVILENTMEDHAAEASGKPLGEISVPLDSSLLCTLSSESHQEAAS    351 - 420
NENDKKPGNYKSMLRPEVGTTSQDSALLDQELYNSFHFWRTPLPEIDLDIELEQNSGGKPSPEGPEEESE    421 - 490
GPVPSSPNITMATRKELEEMIENLEPHIDDPDVKAQVEVLSAALRASSLDAHEETISIEKRSDLQDELDI    491 - 560
NELPNCKINQEDSVPLISDAVENMDSTLHYIHSDSDLSNNSSFSPDEERRTKVQDVVPQALLDQYLSMTD    561 - 630
PSRAQTVDTEIAKHCAYSLPGVALTLGRQNWHCLRETYETLASDMQWKVRRTLAFSIHELAVILGDQLTA    631 - 700
ADLVPIFNGFLKDLDEVRIGVLKHLHDFLKLLHIDKRREYLYQLQEFLVTDNSRNWRFRAELAEQLILLL    701 - 770
ELYSPRDVYDYLRPIALNLCADKVSSVRWISYKLVSEMVKKLHAATPPTFGVDLINELVENFGRCPKWSG    771 - 840
RQAFVFVCQTVIEDDCLPMDQFAVHLMPHLLTLANDRVPNVRVLLAKTLRQTLLEKDYFLASASCHQEAV    841 - 910
EQTIMALQMDRDSDVKYFASIHPASTKISEDAMSTASSTY                                  911 - 950
//

Text Mined References (20)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25134449 2014 The PP4R1 subunit of protein phosphatase PP4 targets TRAF2 and TRAF6 to mediate inhibition of NF-?B activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23084358 2012 A PP4 holoenzyme balances physiological and oncogenic nuclear factor-kappa B signaling in T lymphocytes.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18614045 2008 A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication.
18347064 2008 Protein phosphatase 4 catalytic subunit regulates Cdk1 activity and microtubule organization via NDEL1 dephosphorylation.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16085932 2005 A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity.
15805470 2005 Histone deacetylase 3 (HDAC3) activity is regulated by interaction with protein serine/threonine phosphatase 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11729228 2001 Cloning and characterization of a novel subunit of protein serine/threonine phosphatase 4 from mesangial cells.
10026142 1999 Purification and identification of a novel subunit of protein serine/threonine phosphatase 4.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.