Property Summary

NCBI Gene PubMed Count 44
PubMed Score 260.87
PubTator Score 496.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 3.200 8.7e-06
glioblastoma 1.400 3.8e-04
osteosarcoma 1.208 4.2e-05
group 3 medulloblastoma 1.200 2.6e-04
atypical teratoid / rhabdoid tumor 1.400 1.2e-08
medulloblastoma, large-cell 1.100 6.8e-05
pediatric high grade glioma 1.100 9.3e-08
posterior fossa group A ependymoma 1.100 2.3e-11
lung adenocarcinoma 1.093 1.7e-08
ovarian cancer 2.100 2.4e-06

Gene RIF (25)

PMID Text
27041735 mutual regulatory mechanisms exist between PP4 and SAF-A. Interactions between PP4 and SAF-A played a role in prometaphase/metaphase transition.
25927939 These data suggested a potential role of PP4C in tumor progression.
25320307 Stathmin plays an essential role of in Merkel cell polyomavirus small tumor antigen-mediated microtubule destabilization and cell motility and this process is regulated by cellular phosphatase catalytic subunit of protein phosphatase 4.
24711418 PP4 and Wip1 are differentially required to counteract the p53-dependent cell cycle arrest in G1 and G2, by antagonizing early or late p53-mediated responses, respectively
24265311 Data indicate that the major phosphatase responsible for dephosphorylation of of BAF Ser-4 to be protein phosphatase 4 catalytic subunit.
23966160 Recombinant gamma-tubulin can be phosphorylated by Cdk1-cyclin B or Brsk1 and dephosphorylated by Ppp4c-R2-R3A in vitro.
23830831 PP4c is a key regulator of cortical development that changes the orientation of progenitor division responsible for the transition between symmetric and asymmetric cell division.
23671329 Results show PP4C as a fostriecin-sensitive phosphatase and demonstrate that the suppression of PP4C triggers mitotic slippage/apoptosis.
23084358 PP4R1 and PP4c Cooperate to Catalyze IKK Dephosphorylation
22732494 PP4C and KAP1 are in the same epistasis group, and PP4 is involved in NHEJ-mediated DSB repair, possibly through regulating the phosphorylation status of KAP1.
22665577 Overexpression of PP4C is associated with poor prognosis in patients with stage II pancreatic ductal adenocarcinoma.
22491012 The authors devised a novel proteomic strategy for systematic identification of proteins dephosphorylated by PP4C and identified KRAB-domain-associated protein 1 (KAP-1) as a substrate.
20154705 PP4R2, a regulatory subunit of PP4, mediates the DNA damage-dependent association between RPA2 and the PP4C catalytic subunit.
19539371 PP4 activity significantly affects the mutation rate in leukemic T-cells, indicating that PP4 dysfunction may be important in the development and progression of leukemia
19242545 Observational study of gene-disease association. (HuGE Navigator)
18758438 An evolutionarily conserved gamma histone 2AX phosphatase active on both DNA-damaged and undamaged chromatin.
18715871 PP4R4 forms a novel cytosolic complex with PP4c, independent from the complexes containing PP4R1, PP4R2.PP4R3, and alpha4, and the regulatory subunits of PP4c have evolved different modes of interaction with the catalytic subunit
18614045 A three-protein PP4 phosphatase complex in mammalian cells, containing PP4C, PP4R2, and PP4R3beta, specifically dephosphorylates ATR-mediated gamma-H2AX generated during DNA replication.
18487071 The results suggest that Ppp4c-R2-R3 complexes may co-ordinate centrosome maturation and cell migration via regulation of RhoGTPases.
18424272 Analysis of the role of the serine/threonine protein phosphatase, protein phosphatase 4, in controlling the apoptosis of HEK 293 T cells, using the complementary techniques of gene over-expression and down regulation through RNA interference.
18347064 Our work uncovers a unique regulatory mechanism of MT organization by PP4c through its targets Cdk1 and NDEL1 via regulation of katanin p60 distribution.
15364934 PP4 is a positive regulator for HPK1 and the HPK1-JNK signaling pathway
15331607 IRS-4 is subject to regulation by TNF-alpha, and PP4 mediates TNF-alpha-induced degradation of IRS-4
15073167 protein phosphatase 4 has a role in NF-kappaB p65 Thr dephosphorylation
12668731 Protein phosphatase 4 interacts with the Survival of Motor Neurons complex and enhances the temporal localisation of snRNPs

AA Sequence

MAEISDLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGG      1 - 70
DVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSVTVW     71 - 140
RYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPEDTTGWGVSP    141 - 210
RGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAAILELDEHLQ    211 - 280
KDFIIFEAAPQETRGIPSKKPVADYFL                                               281 - 307
//

Text Mined References (51)

PMID Year Title
27041735 2016 Protein phosphatase 4 plays dual roles during cell proliferation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25927939 2015 High expression of protein phosphatase 4 is associated with the aggressive malignant behavior of colorectal carcinoma.
25320307 2015 Merkel cell polyomavirus small T antigen mediates microtubule destabilization to promote cell motility and migration.
25130464 2014 Leucine methylation of protein phosphatase PP4C at C-terminal is critical for its cellular functions.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24711418 2014 Distinct phosphatases antagonize the p53 response in different phases of the cell cycle.
24265311 2014 Dephosphorylation of barrier-to-autointegration factor by protein phosphatase 4 and its role in cell mitosis.
23966160 2013 Protein phosphatase 4 is phosphorylated and inactivated by Cdk in response to spindle toxins and interacts with ?-tubulin.
23830831 2013 The phosphatase PP4c controls spindle orientation to maintain proliferative symmetric divisions in the developing neocortex.
23671329 2013 Suppression of Ser/Thr phosphatase 4 (PP4C/PPP4C) mimics a novel post-mitotic action of fostriecin, producing mitotic slippage followed by tetraploid cell death.
23084358 2012 A PP4 holoenzyme balances physiological and oncogenic nuclear factor-kappa B signaling in T lymphocytes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22732494 2012 Protein phosphatase PP4 is involved in NHEJ-mediated repair of DNA double-strand breaks.
22665577 2012 Overexpression of protein phosphatase 4 correlates with poor prognosis in patients with stage II pancreatic ductal adenocarcinoma.
22491012 2012 Phosphoproteomic analysis reveals that PP4 dephosphorylates KAP-1 impacting the DNA damage response.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20154705 2010 A PP4 phosphatase complex dephosphorylates RPA2 to facilitate DNA repair via homologous recombination.
19539371 2009 Protein phosphatase 4 regulates apoptosis in leukemic and primary human T-cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19242545 2009 Association and mutation analyses of 16p11.2 autism candidate genes.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18758438 2008 PP4 is a gamma H2AX phosphatase required for recovery from the DNA damage checkpoint.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18614045 2008 A PP4-phosphatase complex dephosphorylates gamma-H2AX generated during DNA replication.
18487071 2008 Depletion of protein phosphatase 4 in human cells reveals essential roles in centrosome maturation, cell migration and the regulation of Rho GTPases.
18424272 2008 Protein phosphatase 4 regulates apoptosis, proliferation and mutation rate of human cells.
18347064 2008 Protein phosphatase 4 catalytic subunit regulates Cdk1 activity and microtubule organization via NDEL1 dephosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17384681 2007 Identification of a PP2A-interacting protein that functions as a negative regulator of phosphatase activity in the ATM/ATR signaling pathway.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16769727 2006 Protein phosphatase 6 subunit with conserved Sit4-associated protein domain targets IkappaBepsilon.
16085932 2005 A novel, evolutionarily conserved protein phosphatase complex involved in cisplatin sensitivity.
15805470 2005 Histone deacetylase 3 (HDAC3) activity is regulated by interaction with protein serine/threonine phosphatase 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15364934 2004 Protein phosphatase 4 is a positive regulator of hematopoietic progenitor kinase 1.
15331607 2004 Protein phosphatase 4 interacts with and down-regulates insulin receptor substrate 4 following tumor necrosis factor-alpha stimulation.
15073167 2004 Suppression of MEK/ERK signaling pathway enhances cisplatin-induced NF-kappaB activation by protein phosphatase 4-mediated NF-kappaB p65 Thr dephosphorylation.
12934076 2003 Functional expression cloning reveals proapoptotic role for protein phosphatase 4.
12668731 2003 Protein phosphatase 4 interacts with the Survival of Motor Neurons complex and enhances the temporal localisation of snRNPs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11698396 2002 Protein phosphatase 4 is involved in tumor necrosis factor-alpha-induced activation of c-Jun N-terminal kinase.
10769191 2000 A novel 50 kDa protein forms complexes with protein phosphatase 4 and is located at centrosomal microtubule organizing centres.
10026142 1999 Purification and identification of a novel subunit of protein serine/threonine phosphatase 4.
9837938 1998 Protein phosphatase X interacts with c-Rel and stimulates c-Rel/nuclear factor kappaB activity.
9647778 1998 Alpha 4 associates with protein phosphatases 2A, 4, and 6.
9359419 1997 Carboxymethylation of nuclear protein serine/threonine phosphatase X.
9177794 1997 Assignment of the human serine/threonine protein phosphatase 4 gene (PPP4C) to chromosome 16p11-p12 by fluorescence in situ hybridization.
8384557 1993 PPX, a novel protein serine/threonine phosphatase localized to centrosomes.
1336397 1992 Protein phosphatase X has been highly conserved during mammalian evolution.