Property Summary

NCBI Gene PubMed Count 17
PubMed Score 34.25
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 1.4e-04
Disease Target Count Z-score Confidence
Complex regional pain syndrome 12 3.264 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.4e-04

Gene RIF (14)

PMID Text
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20107831 Data suggest an association between polymorphisms in PPP3CA, PPP3R1 and PPP3R2 and baseline levels or trainability of endurance phenotype traits.
20107831 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17892862 Data suggest that calcineurin may regulate the kinase activity of CDK4 in a cell cycle-dependent manner and may be an important component of the negative regulation of CDK4.
17684544 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17531200 Here, we report that Cabin1 has additional CN binding domain in its 701-900 amino acid residues.
17324936 calcineurin B potentiates the activation of procaspase-3 by accelerating its proteolytic maturation
16961774 cyclosporin and tacrolimus exert significantly different effects on calcineurin activity in renal transplant patients with stable, well-functioning grafts
15865209 PPP3RL gene localizes to human chromosome 9q22 and transcripts of PPP3RL gene are specifically expressed in the testis.
12482669 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin

AA Sequence

MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEV      1 - 70
DFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIIL     71 - 140
DKDGDGKISFEEFSAVVRDLEIHKKLVLIV                                            141 - 170
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20593291 2010 Polymorphisms in the calcineurin genes are associated with the training responsiveness of cardiac phenotypes in Chinese young adults.
20107831 2010 Are calcineurin genes associated with endurance phenotype traits?
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
17892862 2007 Mitotic regulation of CDK4 by the serine/threonine phosphatase, calcineurin.
17684544 2007 Systematic association mapping identifies NELL1 as a novel IBD disease gene.
17531200 2007 A new calcineurin inhibition domain in Cabin1.
17324936 2007 Calcineurin potentiates the activation of procaspase-3 by accelerating its proteolytic maturation.
16961774 2006 The calcineurin activity profiles of cyclosporin and tacrolimus are different in stable renal transplant patients.
15865209 2005 Characterization of a human regulatory subunit of protein phosphatase 3 gene (PPP3RL) expressed specifically in testis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1718268 1991 cDNA cloning of a novel testis-specific calcineurin B-like protein.