Property Summary

NCBI Gene PubMed Count 17
PubMed Score 39.67
PubTator Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.4e-04
Disease Target Count Z-score Confidence
Complex regional pain syndrome 12 3.175 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 1.4e-04

Protein-protein Interaction (10)

Gene RIF (14)

AA Sequence

MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEV      1 - 70
DFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIIL     71 - 140
DKDGDGKISFEEFSAVVRDLEIHKKLVLIV                                            141 - 170
//

Text Mined References (18)

PMID Year Title