Property Summary

NCBI Gene PubMed Count 63
PubMed Score 391.40
PubTator Score 98.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.100 1.5e-04
astrocytic glioma -3.100 8.8e-03
Astrocytoma, Pilocytic -1.800 2.9e-03
atypical teratoid / rhabdoid tumor -4.400 2.5e-10
ependymoma -3.200 1.6e-02
Gaucher disease type 3 1.200 1.1e-02
glioblastoma -2.000 1.0e-04
group 4 medulloblastoma -2.000 9.3e-03
interstitial lung disease -1.800 9.7e-03
medulloblastoma, large-cell -4.400 7.6e-08
oligodendroglioma -3.000 1.1e-02
osteosarcoma -1.193 6.4e-04
primitive neuroectodermal tumor -2.600 7.1e-05
psoriasis -1.400 1.7e-03
Rheumatoid arthritis 2.500 8.4e-03
subependymal giant cell astrocytoma -1.982 4.0e-02

Gene RIF (39)

AA Sequence

MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV      1 - 70
DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINA     71 - 140
DKDGDGRISFEEFCAVVGGLDIHKKMVVDV                                            141 - 170
//

Text Mined References (65)

PMID Year Title