Property Summary

NCBI Gene PubMed Count 48
PubMed Score 26.89
PubTator Score 23.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma -2.300 6.3e-05
posterior fossa group A ependymoma -1.800 1.4e-09
oligodendroglioma -1.600 1.8e-17
glioblastoma -2.900 9.7e-09
atypical teratoid / rhabdoid tumor -2.400 1.9e-11
medulloblastoma -1.500 1.3e-04
medulloblastoma, large-cell -2.400 2.2e-06
primitive neuroectodermal tumor -1.700 1.1e-04
non-small cell lung cancer 1.097 3.0e-17
colon cancer -1.100 2.8e-05
adult high grade glioma -2.600 1.1e-05
pilocytic astrocytoma -1.700 2.0e-06
subependymal giant cell astrocytoma -1.605 1.2e-02
spina bifida -1.751 3.2e-02
Pick disease -1.100 3.2e-02
invasive ductal carcinoma -1.300 1.1e-03
ovarian cancer -2.600 3.3e-13

Protein-protein Interaction (2)

Gene RIF (26)

PMID Text
25286016 These findings therefore provide initial support for the novel mechanistic hypothesis that oxidation-induced global and/or local conformational changes within calcineurin
24086760 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin
23888774 lower expression of PPP3CA and PPP3CB genes in atrium myocardium can be related to expressed postinfarction LV remodeling.
22739212 Present findings indicate that downregulation of hemoxygenase-1 expression in neutrophils from hypertensive subjects is likely mediated by CN, which acts by hindering translocation to the nucleus of the transcription factor NRF2.
21664352 The expression of a constitutively active Calcineurin stimulates myoblast differentiation, whereas a Calcineurin antisense has the opposite effect.
21531385 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes are potential candidate genes for schizophrenia, especially in patients with deficits in sustained attention and executive function.
21423799 A novel-splicing variant of calcineurin Ass CnAss-FK, which is encoded by an intron-retaining mRNA and is deficient in the autoinhibitory domain, is predominantly expressed in mature follicular keratinocytes.
21233773 The C allele of protein phosphatase 3 subunit alpha rs3804358 polymorphism was overrepresented in athletes compared with controls, whereas the T allele of protein phosphatase 3 subunit beta rs3763679 polymorphism was underrepresented in athletes.
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20700529 two new complementary roles for calcineurin in the regulation of the early UPR (Unfolded Protein Responses)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20593291 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20107831 Observational study of gene-disease association. (HuGE Navigator)
19925438 [review] The nuclear localization sequence, a region spanning amino acids 172-183 of calcineurin A beta, is essential for recognition and shuttling of calcineurin into the nucleus by importin beta.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19659461 calcineurin can dephosphorylate GSK-3beta at Ser-9 and form a stable complex with GSK-3beta, suggesting the possibility that calcineurin regulates the dephosphorylation and activation of GSK-3betain vivo
19287956 calcineurin is inhibited by cyclosporine A, which then exerts multiple effects on human melanoma cell lines HT168 and WM35
19154138 Study demonstrates that all CaN isoforms display the same cytoplasmic subcellular distribution and are expressed in each tested cell line, differences in substrate specificities may determine specific physiological functions of the distinct isoforms.
19136967 TAK1-TAB1-TAB2 selectively induces calcineurin-NFAT signalling through direct phosphorylation of RCAN1, while calcineurin activation diminishes TAK1 signalling by dephosphorylation of TAK1 and TAB1.
18458866 We describe a case of Calcineurin inhibitor-mediated bilateral hippocampal injury after bone marrow transplantation.
18034994 Data show that the calcineurin pathway is activated in hypertrophic myocardium as demonstrated by increased calcineurin activity and expression of calcineurin A-beta and B, and GATA-4, and a shift of cytoplasmic NFAT-3 into the nucleus.
16024800 Calcineurin A beta expression is an additional means of regulating calcineurin activity in the heart.
15557343 depressed NCX activity might contribute to the etiology of in vivo cardiac hypertrophy and dysfunction occurring under conditions in which both calcineurin and protein kinase C are chronically activated
15514034 calcineurin regulates AUF1 posttranslationally in vitro and PTH gene expression in vivo but still allows its physiological regulation by calcium and phosphate
12482669 HIV-1 gp120-induced dephosphorylation of KV2.1 is dependent on NMDA receptor-mediated activation of protein phosphatase 2B or calcineurin

AA Sequence

MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIA      1 - 70
LRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVL     71 - 140
YLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGG    141 - 210
LSPEIHTLDDIRRLDRFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQN    211 - 280
NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPY    281 - 350
WLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS    351 - 420
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINE    421 - 490
RMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ                                        491 - 524
//

Text Mined References (51)

PMID Year Title
25286016 2014 Oxidation-induced conformational changes in calcineurin determined by covalent labeling and tandem mass spectrometry.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
22739212 2012 Calcineurin expression and activity is regulated by the intracellular redox status and under hypertension in human neutrophils.
22688515 2012 Na(+)/H(+) exchanger 1 directly binds to calcineurin A and activates downstream NFAT signaling, leading to cardiomyocyte hypertrophy.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21664352 2011 P43-dependent mitochondrial activity regulates myoblast differentiation and slow myosin isoform expression by control of Calcineurin expression.
21531385 2011 ANXA7, PPP3CB, DNAJC9, and ZMYND17 genes at chromosome 10q22 associated with the subgroup of schizophrenia with deficits in attention and executive function.
21423799 2011 Expression of a constitutively active calcineurin encoded by an intron-retaining mRNA in follicular keratinocytes.
21233773 2011 Are calcineurin genes associated with athletic status? A function, replication study.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20700529 2010 Calcineurin interacts with PERK and dephosphorylates calnexin to relieve ER stress in mammals and frogs.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20593291 2010 Polymorphisms in the calcineurin genes are associated with the training responsiveness of cardiac phenotypes in Chinese young adults.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20107831 2010 Are calcineurin genes associated with endurance phenotype traits?
19925438 2009 Inhibition of the calcineurin-NFAT signalling cascade in the treatment of heart failure.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19659461 2009 Calcineurin dephosphorylates glycogen synthase kinase-3 beta at serine-9 in neuroblast-derived cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19287956 2009 Inhibition of calcineurin by cyclosporine A exerts multiple effects on human melanoma cell lines HT168 and WM35.
19154138 2009 The proline-rich N-terminal sequence of calcineurin Abeta determines substrate binding.
19136967 2009 Interaction between TAK1-TAB1-TAB2 and RCAN1-calcineurin defines a signalling nodal control point.
18458866 2008 Calcineurin inhibitor-mediated bilateral hippocampal injury after bone marrow transplantation.
18034994 Activation of the calcineurin/NFAT signalling cascade starts early in human hypertrophic myocardium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16024800 2005 Regulation of calcineurin through transcriptional induction of the calcineurin A beta promoter in vitro and in vivo.
15557343 2005 Calcineurin inhibits Na+/Ca2+ exchange in phenylephrine-treated hypertrophic cardiomyocytes.
15514034 2005 The protein phosphatase calcineurin determines basal parathyroid hormone gene expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12809556 2003 Phosphorylation of calcipressin 1 increases its ability to inhibit calcineurin and decreases calcipressin half-life.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11970967 2002 Cutting edge: Suppressor of cytokine signaling 3 inhibits activation of NFATp.
11842093 2002 Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.
11714752 2001 Deletion of calcineurin and myocyte enhancer factor 2 (MEF2) binding domain of Cabin1 results in enhanced cytokine gene expression in T cells.
11114196 2000 Calsarcins, a novel family of sarcomeric calcineurin-binding proteins.
11030334 2000 Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.
11005320 2000 Genetic conservation of the immunophilin-binding domains of human calcineurin A1 and A2.
9660947 1998 Selective inhibition of NFAT activation by a peptide spanning the calcineurin targeting site of NFAT.
9655484 1998 Cabin 1, a negative regulator for calcineurin signaling in T lymphocytes.
8978785 1996 Calcineurin A alpha (PPP3CA), calcineurin A beta (PPP3CB) and calcineurin B (PPP3R1) are located on human chromosomes 4, 10q21-->q22 and 2p16-->p15 respectively.
8524402 1995 Crystal structures of human calcineurin and the human FKBP12-FK506-calcineurin complex.
8392375 1993 Molecular cloning of a full-length cDNA encoding the catalytic subunit of human calmodulin-dependent protein phosphatase (calcineurin A alpha).
7593193 1995 Calcineurin functions in Ca(2+)-activated cell death in mammalian cells.
6330098 1984 Mammalian brain phosphoproteins as substrates for calcineurin.
2558868 1989 Isolation and sequence of a cDNA clone for human calcineurin B, the Ca2+-binding subunit of the Ca2+/calmodulin-stimulated protein phosphatase.
2556704 1989 Cloning of human calcineurin A: evidence for two isozymes and identification of a polyproline structural domain.
1848109 1991 Identification of a third alternatively spliced cDNA encoding the catalytic subunit of protein phosphatase 2B beta.
1659808 1991 Chromosomal mapping of the human genes for the calmodulin-dependent protein phosphatase (calcineurin) catalytic subunit.
1321058 1992 Polymerase chain reactions using Saccharomyces, Drosophila and human DNA predict a large family of protein serine/threonine phosphatases.