Property Summary

NCBI Gene PubMed Count 112
Grant Count 159
R01 Count 85
Funding $28,003,412.53
PubMed Score 932.37
PubTator Score 60.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (55)

Disease Z-score Confidence
Cornea plana 12 4.904 2.5
Septic arthritis 8 4.023 2.0
Cancer 2,346 3.789 1.9
Mastitis 48 3.589 1.8
Viral esophagitis 2 3.524 1.8
Osteomyelitis 20 3.522 1.8
Exocrine pancreatic insufficiency 21 3.49 1.7
Toxic shock syndrome 28 3.387 1.7
Erysipeloid 5 3.094 1.5
Atopic dermatitis 944
Breast cancer 3,094
Corneal disease 32 1.0
Hepatolenticular Degeneration 24
Intractable Eczema 5
Keratoconjunctivitis sicca 19
Left Ventricular Hypertrophy 24
Liver transplant rejection 5
Multiple myeloma 1,327
Pancreatitis 97
Peripheral Neuropathy 303
Pick disease 1,893
Prevention of Cardiac Transplant Rejecti... 14 
Prevention of Kidney Transplant Rejectio... 16 
Prevention of Liver Transplant Rejection 14
Prevention of Transplant Rejection 6
Prostatic Neoplasms 471
Renal transplant rejection 13
Rheumatoid Arthritis 1,160
Severe Recalcitrant Psoriasis 11
Tear film insufficiency 14
Testicular Diseases 4
Transplanted organ rejection 10
Waldenstrons macroglobulinemia 765
adult high grade glioma 2,148
aldosterone-producing adenoma 664
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
ependymoma 2,514
glioblastoma 5,572
hereditary spastic paraplegia 313
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
lung cancer 4,466
malignant mesothelioma 3,162
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
severe Alzheimer's disease 49
subependymal giant cell astrocytoma 2,287

Expression

Synonym

Accession Q08209 A1A441 A8K3B7 A8W6Z7 A8W6Z8 B5BUA2 Q8TAW9
Symbols CALN
CCN1
CNA1
CALNA
PPP2B
CALNA1

Gene

PDB

1AUI   1M63   1MF8   2P6B   3LL8   4F0Z   2JOG   2JZI   2R28   2W73   4Q5U   5C1V  

Gene RIF (61)

PMID Text
27009276 CN-A and nephrin were clearly reduced in the kidneys of a 10-year-old boy who had relapsing steroid-resistant nephrotic syndrome.
26812016 that KIF1Bbeta affects mitochondrial dynamics through calcineurin-dependent dephosphorylation of Dynamin-related protein 1 (DRP1), causing mitochondrial fission and apoptosis
25720963 Lysosomal calcium signaling regulates autophagy through calcineurin and TFEB.
25637383 for Aspergillus fumigatus, activation of macrophage calcineurin-NFAT occurs via a phagosomal TLR9-dependent and Bruton's tyrosine kinase-dependent signalling pathway that is independent of MyD88
25286016 These findings therefore provide initial support for the novel mechanistic hypothesis that oxidation-induced global and/or local conformational changes within calcineurin
25122797 Human herpesvirus 6B U54 binds the calcineurin (CaN) phosphatase enzyme, causing improper dephosphorylation and nuclear translocation of NFAT (nuclear factor of activated T cells) proteins, resulting in suboptimal IL-2 gene transcription.
24954618 Data indicate that both nuclear factors of activated T cells (NFATs) motifs partially compete for binding but do not fully displace each other on the calcineurin (Cn) epitope.
24672054 KSR2 deficiency affects stromal interaction molecule 1 (STIM1)/ORAI1 puncta formation, which is correlated with cytoskeleton disorganization.
24298017 PKCepsilon may negatively regulate adverse myocardial remodeling by cooperating with calcineurin to downregulate fibrosis and induce transcription of cardioprotective wound healing genes, including COX-2
24191726 Mutations on the hydrophobic face of Calcineurin distal helix disrupt the structure gained upon CaM binding.
More...

AA Sequence

MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGAS      1 - 70
ILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILY     71 - 140
PKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLD    141 - 210
DIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRA    211 - 280
HEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVF    281 - 350
TWSLPFVGEKVTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV    351 - 420
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM    421 - 490
PSDANLNSINKALTSETNGTDSNGSNSSNIQ                                           491 - 521
//

Text Mined References (120)

PMID Year Title
27009276 2016 Role of calcineurin (CN) in kidney glomerular podocyte: CN inhibitor ameliorated proteinuria by inhibiting the redistribution of CN at the slit diaphragm.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26812016 2016 The 1p36 Tumor Suppressor KIF 1B? Is Required for Calcineurin Activation, Controlling Mitochondrial Fission and Apoptosis.
25720963 2015 Lysosomal calcium signalling regulates autophagy through calcineurin and ?TFEB.
25637383 2015 Phagocytosis-dependent activation of a TLR9-BTK-calcineurin-NFAT pathway co-ordinates innate immunity to Aspergillus fumigatus.
25416956 2014 A proteome-scale map of the human interactome network.
25286016 2014 Oxidation-induced conformational changes in calcineurin determined by covalent labeling and tandem mass spectrometry.
25122797 2014 Inhibition of interleukin-2 gene expression by human herpesvirus 6B U54 tegument protein.
24954618 2014 The LxVP and PxIxIT NFAT motifs bind jointly to overlapping epitopes on calcineurin's catalytic domain distant to the regulatory domain.
24672054 2014 The KSR2-calcineurin complex regulates STIM1-ORAI1 dynamics and store-operated calcium entry (SOCE).
More...