Property Summary

NCBI Gene PubMed Count 57
PubMed Score 9.09
PubTator Score 6.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.300 1.8e-03
dermatomyositis 1.100 5.4e-03
ependymoma 1.300 5.3e-03
gastric carcinoma 1.200 3.4e-02
interstitial cystitis 1.300 8.8e-03
intraductal papillary-mucinous adenoma (... 1.800 2.2e-04
intraductal papillary-mucinous carcinoma... 1.900 1.0e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.5e-02
medulloblastoma, large-cell -1.300 8.5e-04
oligodendroglioma 1.400 1.9e-03
osteosarcoma -1.056 2.3e-02
ovarian cancer -1.700 7.4e-13
Pick disease 1.500 1.7e-06
psoriasis -1.200 3.8e-04
tuberculosis -1.200 3.2e-08
Waldenstrons macroglobulinemia 1.131 1.4e-02

PDB (10)

Gene RIF (29)

AA Sequence

MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKR      1 - 70
AALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEF     71 - 140
FLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKFLGLRAYIRKQINNIFYR    141 - 210
FIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDST    211 - 280
LTEPVVMALLKYWPKTHSPKEVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYW    281 - 350
NNEYIMSLISDNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK    351 - 420
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAHQAQKDPKKDR    421 - 490
PLARRKSELPQDPHTKKALEAHCRADELASQDGR                                        491 - 524
//

Text Mined References (65)

PMID Year Title