Property Summary

NCBI Gene PubMed Count 48
PubMed Score 1.92
PubTator Score 13.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.283 2.3e-04
group 3 medulloblastoma -2.100 7.8e-07
medulloblastoma, large-cell -1.600 8.1e-05
primitive neuroectodermal tumor -1.100 3.0e-04
lung cancer -1.300 3.9e-04
adult high grade glioma -1.100 1.1e-03
ovarian cancer 1.300 9.3e-04

Gene RIF (20)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
24225947 results suggest that PKCalpha can modify PP2A activity by phosphorylation of B56alpha at Ser(41). This interplay between PKCalpha and PP2A represents a new mechanism to regulate important cellular functions like cellular Ca(2+) homeostasis.
23955003 PP2A regulatory subunit Balpha controls endothelial contractility and vessel lumen integrity via regulation of HDAC7.
23287597 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21878643 reversible phosphorylation of Dzip1, which is controlled by the antagonistic action of CK2 and B56-containing PP2As, has an important impact on the stability of Gli transcription factors and Hh signaling.
21874008 Reveal that PPP2R5A, an essential tumour suppressor, tunes the balance of phosphorylation to promote chromosome-spindle interactions during cell division.
21351466 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21075214 The PP2A-B'alpha holoenzyme appears to function as an important endogenous regulator of SK1.
21072166 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21030067 Following TGF-beta1 treatment, recruitment of PP2A-Balpha by TbetaRI increased in benign cells, but not in malignant cells. Inhibition of PP2A in benign cells resulted in an increase in ERK activation and in TGF-beta1 auto-induction after TGF-beta1 treatment.
20378546 B56alpha has a role in nuclear export of the catalytic subunit of PP2A
20160490 The B'alpha subunit of protein phosphatase 2A (PP 2A) as a CHK2 binding partner shows that their interaction is modulated by DNA damage.
19538941 these data indicate that the B subunits alpha and delta are essential for the interaction of PP2A with CaMKIV.
18981217 The B'alpha1 subunit of the serine/threonine protein phosphatase 2A, which binds to cyclin G1, can stabilize cyclin G1 under unstressed conditions and upon DNA damage, as well as inhibit the ability of cyclin G1 to be ubiquitinated.
18957415 PKR regulates B56(alpha)-mediated BCL2 phosphatase activity in acute lymphoblastic leukemia-derived REH cells.
17266553 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
16048649 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
11531413 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
9400615 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
9013886 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen

AA Sequence

MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKDATSNEQQEL      1 - 70
FCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDN     71 - 140
PDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTV    141 - 210
LHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMH    211 - 280
TAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEE    281 - 350
PLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK    351 - 420
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE        421 - 486
//

Text Mined References (56)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24225947 2014 Protein phosphatase 2A is regulated by protein kinase C? (PKC?)-dependent phosphorylation of its targeting subunit B56? at Ser41.
23955003 2013 PP2A regulatory subunit B? controls endothelial contractility and vessel lumen integrity via regulation of HDAC7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21878643 2011 The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.
21874008 2011 Formation of stable attachments between kinetochores and microtubules depends on the B56-PP2A phosphatase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21075214 2011 A critical role for the protein phosphatase 2A B'? regulatory subunit in dephosphorylation of sphingosine kinase 1.
21030067 2010 Overexpression of transforming growth factor ?1 in malignant prostate cells is partly caused by a runaway of TGF-?1 auto-induction mediated through a defective recruitment of protein phosphatase 2A by TGF-? type I receptor.
20378546 2010 Nuclear export and centrosome targeting of the protein phosphatase 2A subunit B56alpha: role of B56alpha in nuclear export of the catalytic subunit.
20160490 2010 Negative regulation of CHK2 activity by protein phosphatase 2A is modulated by DNA damage.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19538941 2009 The Balpha and Bdelta regulatory subunits of PP2A are necessary for assembly of the CaMKIV.PP2A signaling complex.
19131648 2009 miR-1 overexpression enhances Ca(2+) release and promotes cardiac arrhythmogenesis by targeting PP2A regulatory subunit B56alpha and causing CaMKII-dependent hyperphosphorylation of RyR2.
18981217 2009 Lysine-independent turnover of cyclin G1 can be stabilized by B'alpha subunits of protein phosphatase 2A.
18957415 2008 PKR regulates B56(alpha)-mediated BCL2 phosphatase activity in acute lymphoblastic leukemia-derived REH cells.
18782775 2008 Obscurin targets ankyrin-B and protein phosphatase 2A to the cardiac M-line.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17540176 2007 The tumor suppressor PP2A Abeta regulates the RalA GTPase.
17245430 2007 A specific PP2A regulatory subunit, B56gamma, mediates DNA damage-induced dephosphorylation of p53 at Thr55.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16541025 2006 Shugoshin collaborates with protein phosphatase 2A to protect cohesin.
16097049 2005 Screening and identification of proteins interacting with nucleostemin.
15569306 2004 D1 dopamine receptor signaling involves caveolin-2 in HEK-293 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380617 2004 Regulation of Chk2 phosphorylation by interaction with protein phosphatase 2A via its B' regulatory subunit.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690447 2003 Identification of proteins that interact with the central coiled-coil region of the human protein kinase NEK1.
12501214 2002 Site-specific dephosphorylation of endothelial nitric oxide synthase by protein phosphatase 2A: evidence for crosstalk between phosphorylation sites.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12086851 2002 DeltaNp63 induces beta-catenin nuclear accumulation and signaling.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
12058047 2002 Bestrophin interacts physically and functionally with protein phosphatase 2A.
11994459 2002 Inhibition of CTLA-4 function by the regulatory subunit of serine/threonine phosphatase 2A.
11929874 2002 A functional role for the B56 alpha-subunit of protein phosphatase 2A in ceramide-mediated regulation of Bcl2 phosphorylation status and function.
11884620 2002 Protein phosphatase 2A forms a molecular complex with Shc and regulates Shc tyrosine phosphorylation and downstream mitogenic signaling.
11856313 2002 Two conserved domains in regulatory B subunits mediate binding to the A subunit of protein phosphatase 2A.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11397791 2001 Phosphorylation of Thr(495) regulates Ca(2+)/calmodulin-dependent endothelial nitric oxide synthase activity.
10866685 2000 The B56alpha regulatory subunit of protein phosphatase 2A is a target for regulation by double-stranded RNA-dependent protein kinase PKR.
10092233 1999 Regulation of beta-catenin signaling by the B56 subunit of protein phosphatase 2A.
9847399 1999 Binding specificity of protein phosphatase 2A core enzyme for regulatory B subunits and T antigens.
9400615 1997 Increasing the ratio of PP2A core enzyme to holoenzyme inhibits Tat-stimulated HIV-1 transcription and virus production.
9013886 1997 Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812429 1996 Assignment of human protein phosphatase 2A regulatory subunit genes b56alpha, b56beta, b56gamma, b56delta, and b56epsilon (PPP2R5A-PPP2R5E), highly expressed in muscle and brain, to chromosome regions 1q41, 11q12, 3p21, 6p21.1, and 7p11.2 --> p12.
8703017 1996 The B56 family of protein phosphatase 2A (PP2A) regulatory subunits encodes differentiation-induced phosphoproteins that target PP2A to both nucleus and cytoplasm.
8702385 1996 Complex formation of JAK2 with PP2A, P13K, and Yes in response to the hematopoietic cytokine interleukin-11.
8694763 1996 The variable subunit associated with protein phosphatase 2A0 defines a novel multimember family of regulatory subunits.
7592815 1995 Identification of a new family of protein phosphatase 2A regulatory subunits.