Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.48
PubTator Score 20.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 8.2e-03
Atopic dermatitis 1.100 3.5e-04
atypical teratoid / rhabdoid tumor 1.200 4.8e-04
ependymoma 1.100 3.7e-04
glioblastoma 1.300 5.2e-04
group 3 medulloblastoma 1.400 4.8e-04
malignant mesothelioma 1.900 5.3e-06
oligodendroglioma 1.100 1.1e-02
primitive neuroectodermal tumor 1.200 1.4e-02
psoriasis 1.400 2.6e-04

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MPPGKVLQPVLKMKVDELFLYWLSEASTQRMLQDCLRRIKAPGRDQPTPGDGEQPGAWPTAPLAAPRPSG      1 - 70
LEPPGTPGPGPALPLGAASSPRNAPHVRGTRRSAGTRVVQTRKEEPLPPATSQSIPTFYFPRGRPQDSVN     71 - 140
VDAVISKIESTFARFPHERATMDDMGLVAKACGCPLYWKGPLFYGAGGERTGSVSVHKFVAMWRKILQNC    141 - 210
HDDAAKFVHLLMSPGCNYLVQEDFVPFLQDVVNTHPGLSFLKEASEFHSRYITTVIQRIFYAVNRSWSGR    211 - 280
ITCAELRRSSFLQNVALLEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDADDLARHNDHALSTK    281 - 350
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQ    351 - 420
CRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLR    421 - 490
DGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAV    491 - 560
DLYEYACGDEDLEPL                                                           561 - 575
//

Text Mined References (17)

PMID Year Title