Property Summary

NCBI Gene PubMed Count 74
PubMed Score 55.16
PubTator Score 42.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.400 3.0e-04
sonic hedgehog group medulloblastoma -3.800 2.9e-08
glioblastoma -1.800 5.4e-03
atypical teratoid / rhabdoid tumor -4.400 6.5e-09
medulloblastoma, large-cell -1.300 2.2e-02
tuberculosis 1.200 3.9e-04
intraductal papillary-mucinous carcinoma... -1.200 2.5e-04
colon cancer -1.200 4.0e-04
diabetes mellitus 1.200 1.9e-03
interstitial cystitis -1.900 1.2e-03
pediatric high grade glioma -1.600 1.5e-03
lung carcinoma 1.800 5.0e-23
Pick disease -1.200 2.3e-03
Breast cancer -1.300 3.2e-38
ovarian cancer -1.800 4.6e-04
type I diabetes mellitus -1.050 1.5e-02

Gene RIF (69)

PMID Text
26653855 Thus, Fcp1 coordinates Cdk1 and Gwl inactivation to derepress PP2A-B55, generating a dephosphorylation switch that drives mitosis progression.
25816751 IER5 functions as a positive feedback regulator of HSF1 and that this process involves PP2A/B55 and HSF1 dephosphorylation.
25634432 investigated CAG copies within PPP2R2B in 29 patients with spinocerebellar ataxia who are excluded from the most common subtypes; 3 patients carried 53, 46 and 54 CAG repeats respectively, while the other 26 cases harbored CAG repeats less than 30
25082878 Bcl-2 phosphorylation at Ser70 by selective tyrosine nitration of PP2A-B56delta stabilizes its antiapoptotic activity
24676687 Inactivation of protein-phosphatase 2A causing hyperphosphorylation of paraprotein targets in monoclonal gammopathy of undetermined significance, multiple myeloma and Waldenstrom's macroglobulinemia is due to an exchange of its regulatory subunits
24509904 PP2A-B55beta promotes cyclin E1 overexpression by antagonizing its degradation and its inhibition could represent a therapeutic mechanism for abrogating cyclin E1 function in cancers
24391510 We demonstrate that PP2A/B55 is required for Gwl dephosphorylation at the essential Cdk site Thr194. Ensa/ARPP19 dephosphorylation is mediated by the RNA
24244166 Identification of the adenovirus E4orf4 protein binding site on the B55alpha and Cdc55 regulatory subunits of PP2A: Implications for PP2A
24157919 Bod1 regulates protein phosphatase 2A at mitotic kinetochores.
23381641 Differential autophagic neuronal cell death under stress is determined by the cytoplasmic and mitochondrial-specific PPP2R2B isoforms.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23034890 Single nucleotide polymorphisms in PPP2R2B is associated with drug response in breast cancer.
22583914 Data indicate that PPP2R2B gene product PP2A/Bbeta2 activates the mitochondrial fission enzyme dynamin-related protein 1 (Drp1) by dephosphorylating Ser656.
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21827912 This study suggested that PPP2R2B CAG expansion mutation might lead increase induction of Spinocerebellar ataxia type 12.
21746932 defective production of PP2A Bbeta upon IL-2 deprivation results in apoptosis resistance and longer survival of autoreactive T cells, in a subset of SLE patients
21471219 oxidative stress induced by mitochondrial dysfunction causes elevated expression of ppp2r2b and plays a causal role in SCA12; and reduction of ROS is a potential therapeutic intervention for this neuropathy
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21075311 PPP2R2B, encoding the B55beta regulatory subunit of the PP2A complex, is epigenetically inactivated by DNA hypermethylation in colorectal cancer.
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21029765 CAG repeat lengths in the PPP2R2B gene may be potential genetic markers for Alzheimer disease susceptibility in the Japanese population.
21029765 Observational study of gene-disease association. (HuGE Navigator)
20937954 Autosomal dominant cerebellar ataxia mapping to 5q31-q33.1 has no CAG repeat expansion or other mutations of the PPP2R2B gene.
20669227 results indicate that the A variant of the rs319217 SNP of the PPP2R2B gene is a marker of better prognosis in breast cancer
20669227 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20533062 The CAG repeat in SCA12 functions as a cis element to up-regulate PPP2R2B expression.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20338046 We investigated methylation patterns in the promoter regions of ABCB1, ATM, BRCA1, CDH3, CDKN2A, CXCR4, ESR1, FBXW7, FOXC1, GSTP1, IGF2, HMLH1, PPP2R2B, and PTEN75 in well-described pre-treatment samples from locally advanced breast cancer
20237496 Observational study of gene-disease association. (HuGE Navigator)
20056007 Quantitative methylation analysis identified ABCB1, FOXC1, PPP2R2B and PTEN as novel genes to be methylated in ductal carcinoma in situ.
20017961 Cells with ectopically expressed PPP2R2B were shown predisposed to autophagy and oxidative stress induced cell death.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19259763 Observational study of gene-disease association. (HuGE Navigator)
19235102 Observational study of gene-disease association. (HuGE Navigator)
18973067 Results suggest that Parkinsonism (PD) and multiple system atrophy (MSA) are not associated with spinocerebellar ataxia 12 (SCA12) and it is not necessary to screen SCA12 in PD and MSA patients.
18971272 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18653458 Adenovirus E4orf4 protein downregulates MYC expression through interaction with the PP2A-B55 subunit
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18484086 results suggest that the PPP2R2B gene CAG repeat polymorphism may be functional and may, in part, play a role in conferring susceptibility to Alzheimer disease and essential tremor in Taiwan
18484086 Observational study of gene-disease association. (HuGE Navigator)
17529992 The small t antigen (ST) of DNA tumor virus SV40 inhibits PP2A phosphatase activity through its N-terminal J domain.
17266553 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
17123511 Cyclin G2 may modulate the cell cycle and cellular division processes through modulation of PP2A and centrosomal associated activities.
16475161 PP2A-mediated dephosphorylation of HSP27 and tau correlated with PP2A-induced preservation of endothelial cell cytoskeleton
16286244 The tumor suppressor PP2A is functionally inactivated in blast crisis CML through the inhibitory activity of the BCR/ABL-regulated SET protein.
16245300 We therefore propose that PP2A plays a crucial role in the maintenance of cell-cell adhesion through recruitment of IQGAP1 to the Rac-bound E-cadherin-catenins complex.
16138911 analysis of a founder for SCA12 in the Indian population
16126728 PP2A plays a positive rather than a negative role in the regulation of IKKbeta
16109716 phospholipase D suppresses protein phosphatase 2A and is involved in the mTOR survival pathway in the transformation of human cells
16054804 Observational study of gene-disease association. (HuGE Navigator)
16048649 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15817944 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15780175 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15638722 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15578586 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15148151 Observational study of genotype prevalence. (HuGE Navigator)
14960773 Observational study of genotype prevalence. (HuGE Navigator)
14960773 Analysis of CTA/CTG and CAG polymorphism in a Polish control group.
12497613 Observational study of gene-disease association. (HuGE Navigator)
12140678 Observational study of gene-disease association. (HuGE Navigator)
12140678 SCA12 triplet expansion rate in Italian ataxia patients
12058047 Phosphorylation of bestrophin is regulated by PP2A.
11983168 Cyclin G recruits PP2A in order to modulate the phosphorylation of Mdm2 and thereby to regulate both Mdm2 and p53.
11956189 cyclin G2 also associates with various PP2A B' regulatory subunits, as previously shown for cyclin G1
11723136 a novel ATM-dependent mechanism is regulating association of B55 subunits with nuclear PP2A in response to IR
11531413 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9400615 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9013886 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells

AA Sequence

MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQVHRRGEYNVY      1 - 70
STFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKVSERDKRPEGYNLKDEEGRLR     71 - 140
DPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDLRINLWNFEITNQSFNI    141 - 210
VDIKPANMEELTEVITAAEFHPHHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEI    211 - 280
ISSISDVKFSHSGRYIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSD    281 - 350
SVIMTGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW    351 - 420
HPSENIIAVAATNNLYIFQDKVN                                                   421 - 443
//

Text Mined References (73)

PMID Year Title
26653855 2015 Fcp1 phosphatase controls Greatwall kinase to promote PP2A-B55 activation and mitotic progression.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26002199 2015 The Repeat Expansion Diseases: The dark side of DNA repair.
25816751 2015 HSF1 transcriptional activity is modulated by IER5 and PP2A/B55.
25634432 2015 Identification of 46 CAG repeats within PPP2R2B as probably the shortest pathogenic allele for SCA12.
25082878 2014 Ser70 phosphorylation of Bcl-2 by selective tyrosine nitration of PP2A-B56? stabilizes its antiapoptotic activity.
24676687 2014 Inactivation of protein-phosphatase 2A causing hyperphosphorylation of autoantigenic paraprotein targets in MGUS/MM is due to an exchange of its regulatory subunits.
24509904 2014 PP2A-B55? antagonizes cyclin E1 proteolysis and promotes its dysregulation in cancer.
24391510 2014 PP2A/B55 and Fcp1 regulate Greatwall and Ensa dephosphorylation during mitotic exit.
24244166 2013 Identification of the adenovirus E4orf4 protein binding site on the B55? and Cdc55 regulatory subunits of PP2A: Implications for PP2A function, tumor cell killing and viral replication.
24157919 2013 Bod1 regulates protein phosphatase 2A at mitotic kinetochores.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23381641 2013 Differential autophagic cell death under stress with ectopic cytoplasmic and mitochondrial-specific PPP2R2B in human neuroblastoma cells.
23034890 2013 Germline variation in TP53 regulatory network genes associates with breast cancer survival and treatment outcome.
22583914 2013 N-terminal phosphorylation of protein phosphatase 2A/B?2 regulates translocation to mitochondria, dynamin-related protein 1 dephosphorylation, and neuronal survival.
21827912 2012 Spinocerebellar ataxia type 12.
21746932 2011 Induction of PP2A B?, a regulator of IL-2 deprivation-induced T-cell apoptosis, is deficient in systemic lupus erythematosus.
21471219 2011 Mitochondrial dysfunction and oxidative stress contribute to the pathogenesis of spinocerebellar ataxia type 12 (SCA12).
21075311 2010 B55?-associated PP2A complex controls PDK1-directed myc signaling and modulates rapamycin sensitivity in colorectal cancer.
21029765 2011 Association between CAG repeat length in the PPP2R2B gene and Alzheimer disease in the Japanese population.
20937954 2010 Mapping of autosomal dominant cerebellar ataxia without the pathogenic PPP2R2B mutation to the locus for spinocerebellar ataxia 12.
20669227 2011 A genetic variant in a PP2A regulatory subunit encoded by the PPP2R2B gene associates with altered breast cancer risk and recurrence.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20533062 2010 The CAG repeat in SCA12 functions as a cis element to up-regulate PPP2R2B expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20338046 2010 DNA methylation profiling in doxorubicin treated primary locally advanced breast tumours identifies novel genes associated with survival and treatment response.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20056007 2010 Frequent aberrant DNA methylation of ABCB1, FOXC1, PPP2R2B and PTEN in ductal carcinoma in situ and early invasive breast cancer.
20017961 2009 Oxidative stress promotes autophagic cell death in human neuroblastoma cells with ectopic transfer of mitochondrial PPP2R2B (Bbeta2).
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19581569 2009 Genome-wide association study of alcohol dependence.
19259763 2009 The genetic aetiology of late-onset chronic progressive cerebellar ataxia. A population-based study.
19235102 Screening for premutation in the FMR1 gene in male patients suspected of spinocerebellar ataxia.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18973067 2008 Spinocerebellar ataxia type 12 was not found in Korean Parkinsonian patients.
18653458 2008 Adenovirus E4orf4 protein downregulates MYC expression through interaction with the PP2A-B55 subunit.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18484086 2009 PPP2R2B CAG repeat length in the Han Chinese in Taiwan: Association analyses in neurological and psychiatric disorders and potential functional implications.
17903297 2007 Genetic correlates of brain aging on MRI and cognitive test measures: a genome-wide association and linkage analysis in the Framingham Study.
17529992 2007 Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40.
17123511 2006 Cyclin G2 is a centrosome-associated nucleocytoplasmic shuttling protein that influences microtubule stability and induces a p53-dependent cell cycle arrest.
16596250 2006 Protein phosphatase 2A interacts with Chk2 and regulates phosphorylation at Thr-68 after cisplatin treatment of human ovarian cancer cells.
16475161 2006 Role of protein phosphatase 2A in the regulation of endothelial cell cytoskeleton structure.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16286244 2005 The tumor suppressor PP2A is functionally inactivated in blast crisis CML through the inhibitory activity of the BCR/ABL-regulated SET protein.
16245300 2006 Involvement of protein phosphatase 2A in the maintenance of E-cadherin-mediated cell-cell adhesion through recruitment of IQGAP1.
16138911 2005 Evidence of a common founder for SCA12 in the Indian population.
16126728 2005 Positive regulation of IkappaB kinase signaling by protein serine/threonine phosphatase 2A.
16109716 2005 mTOR-dependent suppression of protein phosphatase 2A is critical for phospholipase D survival signals in human breast cancer cells.
16054804 2005 Expanded trinucleotide repeats in the TBP/SCA17 gene mapped to chromosome 6q27 are associated with schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15148151 2004 Molecular genetics of hereditary spinocerebellar ataxia: mutation analysis of spinocerebellar ataxia genes and CAG/CTG repeat expansion detection in 225 Italian families.
14960773 2004 Polymorphism of trinucleotide repeats in non-translated regions of SCA8 and SCA12 genes: allele distribution in a Polish control group.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12912990 2003 Cytosolic Arl2 is complexed with cofactor D and protein phosphatase 2A.
12497613 2003 CAG repeat polymorphisms in KCNN3 (HSKCa3) and PPP2R2B show no association or linkage to schizophrenia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140678 2002 Analysis of SCA8 and SCA12 loci in 134 Italian ataxic patients negative for SCA1-3, 6 and 7 CAG expansions.
12058047 2002 Bestrophin interacts physically and functionally with protein phosphatase 2A.
11983168 2002 Cyclin G recruits PP2A to dephosphorylate Mdm2.
11956189 2002 Cyclin G2 associates with protein phosphatase 2A catalytic and regulatory B' subunits in active complexes and induces nuclear aberrations and a G1/S phase cell cycle arrest.
11723136 2002 ATM-dependent dissociation of B55 regulatory subunit from nuclear PP2A in response to ionizing radiation.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11198281 2001 SCA12 is a rare locus for autosomal dominant cerebellar ataxia: a study of an Indian family.
10581021 1999 Expansion of a novel CAG trinucleotide repeat in the 5' region of PPP2R2B is associated with SCA12.
10322434 1999 Regulation of protein kinase cascades by protein phosphatase 2A.
9514514 1998 Brain protein phosphatase 2A: developmental regulation and distinct cellular and subcellular localization by B subunits.
9400615 1997 Increasing the ratio of PP2A core enzyme to holoenzyme inhibits Tat-stimulated HIV-1 transcription and virus production.
9013886 1997 Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
8348150 1993 Direct detection of novel expanded trinucleotide repeats in the human genome.
1849734 1991 Structure of the 55-kDa regulatory subunit of protein phosphatase 2A: evidence for a neuronal-specific isoform.