Property Summary

NCBI Gene PubMed Count 59
PubMed Score 14.55
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 9.5e-03
ependymoma 1.200 2.6e-02
osteosarcoma -1.403 1.8e-05
glioblastoma -1.100 1.3e-04
group 4 medulloblastoma -1.600 1.5e-08
pancreatic ductal adenocarcinoma liver m... 1.136 1.5e-03
intraductal papillary-mucinous adenoma (... 1.500 4.5e-04
intraductal papillary-mucinous carcinoma... 1.700 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-02
Breast cancer -1.100 9.4e-06
ovarian cancer -2.000 5.0e-12

Synonym

Accession P63151 B2RBU8 B4E1T7 P50409 Q00007
Symbols B55A
PR52A
PR55A
B55ALPHA

Gene

PDB

3DW8  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (47)

PMID Text
26310906 Concurrent mTORC1 inactivation and PP2A-B55alpha stimulation fuel ULK1-dependent autophagy.
26297546 miR-556-5p functions as an onco-miRNA and participates in prostate cancer carcinogenesis by suppressing PPP2R2A expression.
26054685 overexpression of miR-892a may provide a selective growth promotion for colorectal cancer cells by direct suppression of PPP2R2A expression.
25879784 Data show that breast cancer (BC) with PPP2R2A deletions are associated with worse overall survival, and the combination of altered PPP2R2A and high CCND1 expression define a subgroup of luminal-like BC patients with a high risk of relapse and death.
25654102 miR-136 may play an important role during TGF-beta1-induced proliferation arrest by targeting PPP2R2A in keratinocytes.
25238119 Data suggest livers of biliary atresia subjects exhibit overexpression of MIR222 (microRNA 222); this appears to contribute to liver fibrosis (and in vitro cell proliferation) by targeting PPP2R2A (protein phosphatase 2A subunit B) and Akt signaling.
24858343 The suppression of B55alpha activates signaling pathways that could support leukemia cell survival.
24244166 Identification of the adenovirus E4orf4 protein binding site on the B55alpha and Cdc55 regulatory subunits of PP2A: Implications for PP2A
23959478 miR-136 promotes Erk1/2 phosphorylation through targeting PPP2R2A in NSCLC cells and suggest that it may serve as a therapeutic target in NSCLC therapy.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23087057 PPP2R2A status may serve as a marker to predict therapeutic efficacy to PARP inhibition.
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22417654 Both B55alpha and nuclear forkhead box O1 protein (FOXO1) levels are increased under hyperglycemic conditions in transgenic db/db mouse islets, an animal model of type 2 diabetes.
22174317 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21872824 Somatic deletion rather than germline sequence variants of PPP2R2A may play a more important role in prostate cancer susceptibility.
21813648 These data demonstrate that B55alpha acts to antagonize Cyclin A/Cdk-dependent activation of FoxM1, to ensure that FoxM1 activity is restricted to the G(2) phase of the cell cycle.
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21047956 The interaction of human adenovirus E4orf4 with both Cdc55 and B55 involves residues within blades 1 and 2, a finding that is consistent with the idea that E4orf4 binding may block the dephosphorylation of at least some PP2A substrates.
20711181 Results demonstrate that PP2A-B55alpha and importin-beta1 cooperate in the regulation of postmitotic assembly mechanisms in human cells.
19890961 Observational study of gene-disease association. (HuGE Navigator)
19556239 The results suggest that PR55 alpha specifically regulates PP2A-mediated beta-catenin dephosphorylation and plays an essential role in Wnt signaling.
19535438 The authors show that E4orf4 protein interacts uniquely with B55 family subunits and that cell killing increases with the level of E4orf4 expression.
18971272 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
18697906 These highly related members of the same subfamily of PP2A regulatory subunits differentially regulate TGF-beta/Activin/Nodal signalling to elicit opposing biological outcomes.
18670647 Homozygous deletions in a number of biologically important genes were found in prostate cancer cell lines, including PPP2R2A and BNIP3L identified in this study.
18339811 PP2A constitutively dephosphorylates the class IIa member HDAC7 to control its biological functions as a regulator of T cell apoptosis and endothelial cell functions.
18187620 Knockdown of protein phosphatase 2, regulatory subunit B, alpha (PPP2R2A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17693407 the protein phosphatase 2A regulatory subunit alpha4 has a novel role in the regulation of cell spreading and migration
17604273 Protein phosphatase 2A and separase form a complex regulated by separase autocleavage
17266553 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
17255109 PP2A binding to Sprouty2 and phosphorylation changes are a prerequisite for ERK inhibition downstream of FGFR stimulation
17055435 The scaffolding subunit exhibits considerable conformational flexibility, which is proposed to play an essential role in PP2A function.
16790090 deregulation of CHEK2 and/or PPP2R2A is of pathogenetic importance in at least a subset of germ cell tumors
16580887 Bub1 targets PP2A to centromeres, which in turn maintains Sgo1 at centromeres by counteracting Plk1-mediated chromosome removal of Sgo1.
16474850 hAR is a direct target of LEF-1/TCF transcriptional regulation in PCa cells; expression of the hAR protein is suppressed by a degradation pathway regulated by cross-talk of Wnt, Akt, and PP2A
16239230 PP2A ABalphaC and ABdeltaC holoenzymes function as positive regulators of Raf1-MEK1/2-ERK1/2 signaling by targeting Raf1
16239222 CFTR is regulated by a direct interaction with the protein phosphatase 2A
16048649 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15725353 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15638722 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15578586 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
15142377 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
11956189 cyclin G2 also associates with various PP2A B' regulatory subunits, as previously shown for cyclin G1
11531413 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9400615 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9013886 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells

AA Sequence

MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGE      1 - 70
YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEED     71 - 140
GRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDR    141 - 210
SFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSF    211 - 280
FSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCW    281 - 350
NGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL    351 - 420
HTAWHPKENIIAVATTNNLYIFQDKVN                                               421 - 447
//

Text Mined References (64)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26310906 2015 Regulation of autophagy by coordinated action of mTORC1 and protein phosphatase 2A.
26297546 2015 Upregulation of miR-556-5p promoted prostate cancer cell proliferation by suppressing PPP2R2A expression.
26054685 2015 miR-892a regulated PPP2R2A expression and promoted cell proliferation of human colorectal cancer cells.
25879784 2015 Altered PPP2R2A and Cyclin D1 expression defines a subgroup of aggressive luminal-like breast cancer.
25654102 2015 miR-136 modulates TGF-?1-induced proliferation arrest by targeting PPP2R2A in keratinocytes.
25238119 2015 miR-222 overexpression may contribute to liver fibrosis in biliary atresia by targeting PPP2R2A.
24858343 2014 The protein phosphatase 2A regulatory subunit B55? is a modulator of signaling and microRNA expression in acute myeloid leukemia cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24244166 2013 Identification of the adenovirus E4orf4 protein binding site on the B55? and Cdc55 regulatory subunits of PP2A: Implications for PP2A function, tumor cell killing and viral replication.
23959478 2014 Upregulation of miR-136 in human non-small cell lung cancer cells promotes Erk1/2 activation by targeting PPP2R2A.
23878394 2013 Phosphorylation regulates FOXC2-mediated transcription in lymphatic endothelial cells.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23087057 2012 Loss of PPP2R2A inhibits homologous recombination DNA repair and predicts tumor sensitivity to PARP inhibition.
22417654 2012 The B55?-containing PP2A holoenzyme dephosphorylates FOXO1 in islet ?-cells under oxidative stress.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21872824 2011 Evaluation of PPP2R2A as a prostate cancer susceptibility gene: a comprehensive germline and somatic study.
21813648 2011 Protein phosphatase 2A (B55?) prevents premature activation of forkhead transcription factor FoxM1 by antagonizing cyclin A/cyclin-dependent kinase-mediated phosphorylation.
21269460 2011 Initial characterization of the human central proteome.
21047956 2011 Genetic analysis of B55alpha/Cdc55 protein phosphatase 2A subunits: association with the adenovirus E4orf4 protein.
20711181 2010 Live-cell imaging RNAi screen identifies PP2A-B55alpha and importin-beta1 as key mitotic exit regulators in human cells.
19890961 2010 Protein phosphatase 2A subunit gene haplotypes and proliferative breast disease modify breast cancer risk.
19556239 2009 PR55 alpha, a regulatory subunit of PP2A, specifically regulates PP2A-mediated beta-catenin dephosphorylation.
19535438 2009 The adenovirus E4orf4 protein induces G2/M arrest and cell death by blocking protein phosphatase 2A activity regulated by the B55 subunit.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19293187 2009 PME-1 protects extracellular signal-regulated kinase pathway activity from protein phosphatase 2A-mediated inactivation in human malignant glioma.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18697906 2008 Two highly related regulatory subunits of PP2A exert opposite effects on TGF-beta/Activin/Nodal signalling.
18670647 2008 Homozygous deletions and recurrent amplifications implicate new genes involved in prostate cancer.
18339811 2008 Protein phosphatase 2A controls the activity of histone deacetylase 7 during T cell apoptosis and angiogenesis.
17693407 2007 The PP2A-associated protein alpha4 plays a critical role in the regulation of cell spreading and migration.
17632056 2007 CIP2A inhibits PP2A in human malignancies.
17604273 2007 Protein phosphatase 2A and separase form a complex regulated by separase autocleavage.
17540176 2007 The tumor suppressor PP2A Abeta regulates the RalA GTPase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17255109 2007 Direct binding of PP2A to Sprouty2 and phosphorylation changes are a prerequisite for ERK inhibition downstream of fibroblast growth factor receptor stimulation.
17245430 2007 A specific PP2A regulatory subunit, B56gamma, mediates DNA damage-induced dephosphorylation of p53 at Thr55.
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17055435 2006 Structure of protein phosphatase 2A core enzyme bound to tumor-inducing toxins.
16790090 2006 Fusion of the tumor-suppressor gene CHEK2 and the gene for the regulatory subunit B of protein phosphatase 2 PPP2R2A in childhood teratoma.
16580887 2006 PP2A is required for centromeric localization of Sgo1 and proper chromosome segregation.
16474850 2006 Complex regulation of human androgen receptor expression by Wnt signaling in prostate cancer cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16239230 2005 Positive regulation of Raf1-MEK1/2-ERK1/2 signaling by protein serine/threonine phosphatase 2A holoenzymes.
16239222 2005 The cystic fibrosis transmembrane conductance regulator is regulated by a direct interaction with the protein phosphatase 2A.
15761952 2005 Single-step Strep-tag purification for the isolation and identification of protein complexes from mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956189 2002 Cyclin G2 associates with protein phosphatase 2A catalytic and regulatory B' subunits in active complexes and induces nuclear aberrations and a G1/S phase cell cycle arrest.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11259128 2001 PP2A mRNA expression is quantitatively decreased in Alzheimer's disease hippocampus.
11007961 2000 Type 2A protein phosphatase, the complex regulator of numerous signaling pathways.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10681496 2000 WD40 repeat proteins striatin and S/G(2) nuclear autoantigen are members of a novel family of calmodulin-binding proteins that associate with protein phosphatase 2A.
9847399 1999 Binding specificity of protein phosphatase 2A core enzyme for regulatory B subunits and T antigens.
9774674 1998 Physical and functional interactions between type I transforming growth factor beta receptors and Balpha, a WD-40 repeat subunit of phosphatase 2A.
9514514 1998 Brain protein phosphatase 2A: developmental regulation and distinct cellular and subcellular localization by B subunits.
9400615 1997 Increasing the ratio of PP2A core enzyme to holoenzyme inhibits Tat-stimulated HIV-1 transcription and virus production.
9013886 1997 Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
1849734 1991 Structure of the 55-kDa regulatory subunit of protein phosphatase 2A: evidence for a neuronal-specific isoform.
1328247 1992 Expression of the A subunit of protein phosphatase 2A and characterization of its interactions with the catalytic and regulatory subunits.