Property Summary

Ligand Count 1
NCBI Gene PubMed Count 67
PubMed Score 14.44
PubTator Score 25.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 9.5e-03
Breast cancer -1.100 9.4e-06
ependymoma 1.200 2.6e-02
glioblastoma -1.100 1.3e-04
group 4 medulloblastoma -1.600 1.5e-08
intraductal papillary-mucinous adenoma (... 1.500 4.5e-04
intraductal papillary-mucinous carcinoma... 1.700 3.2e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.0e-02
osteosarcoma -1.403 1.8e-05
ovarian cancer -1.100 7.8e-04
pancreatic ductal adenocarcinoma liver m... 1.136 1.5e-03

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (51)

AA Sequence

MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQENKIQSHSRGE      1 - 70
YNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEED     71 - 140
GRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDR    141 - 210
SFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSF    211 - 280
FSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCW    281 - 350
NGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL    351 - 420
HTAWHPKENIIAVATTNNLYIFQDKVN                                               421 - 447
//

Text Mined References (72)

PMID Year Title