Property Summary

NCBI Gene PubMed Count 86
PubMed Score 25.31
PubTator Score 31.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis -1.200 2.7e-02

Protein-protein Interaction (221)

SFI1   PLK4   AURKA   CEP290   CASC3   NPHP1   CCP110   SPRY2   SSNA1   NPHP4   HMMR   BANF1   OFD1   DCTN3   HAUS5   CEP152   CCNB2   PCNT   FGFR1OP   LMNA   TUBB4A   RPLP1   RPLP2   RPLP0   CDK1   TUBB   HSP90AA1   RPS17   RPSA   UBB   UBC   PABPC1   SRC   CCNB1   GSPT1   RPS2   PRKACA   RPL35A   RPL7   RPL17   RPS4Y1   CBL   TUBG1   RPS3   RPS12   RPL13   RPL10   RPL12   PRKAR2B   RPL9   RPL22   RPL4   EIF4A3   RPS19   RPL3   RPL13A   CETN2   RPS27   RPL35   PAFAH1B1   RPL27A   RPL5   RPL21   RPL28   RPS9   RPS5   RPS10   RPL29   CSNK1D   RPL34   CSNK1E   EMD   RPL14   NEK2   NCBP2   PLK1   RPS20   RAB8A   ACTR1A   RPS3A   RPL26   RPL15   MAGOH   RPL27   RPL37A   RPL37   RPS7   RPS8   RPS15A   RPS16   RPS14   RPS23   RPS18   RPS29   RPS13   RPS11   RPL7A   RAB11A   ETF1   RPS4X   PPP2CB   RPL23A   RPS6   RPL23   RPS15   RPS24   RPS25   RPS26   RPS28   FAU   RPL30   RPL39   RPL31   RPL10A   RPL32   RPL11   RPL8   RPL41   RPS27A   UBA52   GRB2   PPP2R2A   DYNLL1   RPL38   RPS21   PPP2CA   TUBA4A   TUBB4B   RPL24   RPL36A   RPL19   RPL18A   RPL6   EIF4G1   PTPN11   RPL18   NCBP1   DYNC1I2   DCTN2   CKAP5   DCTN1   DYNC1H1   IQCB1   PCM1   RNPS1   MAPRE1   TCTN1   C2CD3   ODF2   TMEM67   CEP78   KIF24   CEP162   CEP135   RPGRIP1L   HAUS3   TTBK2   TCTN3   BORA   TUBA1A   CLASP1   HAUS6   CNTRL   SDCCAG8   SMG6   CEP57   CEP97   GSPT2   AHI1   CEP70   NEDD1   CEP76   ALMS1   CEP192   FBF1   SMG7   UPF1   MAGOHB   HAUS1   OPTN   TUBGCP3   TCTN2   AJUBA   MARK4   CEP63   SCLT1   RAB3IP   TUBGCP6   TUBGCP5   CDK5RAP2   CEP89   HAUS7   AKAP9   B9D2   TUBGCP2   HAUS8   MKNK1   CEP250   CEP41   UPF3B   UPF3A   HAUS4   UPF2   CENPJ   TUBG2   HAUS2   MKS1   NDE1   TMEM216   CEP72   CC2D2A   TUBGCP4   TPX2   B9D1   CEP131   SMG5   CEP164   NINL   RPL36   CEP83   RBM8A  

Gene RIF (36)

PMID Text
24885237 Our results suggest that IH-induced ROS generation increases PP2A activation and subsequently downregulates ERK1/2 activation, which results in inhibition of PC12 cell proliferation through G0/G1 phase arrest and NGF-induced neuronal differentiation.
24465463 PR65A phosphorylation regulates PP2A complex signaling.
24204789 The two functional variants in PPP2R1A and PPP2R5E and their combinations are associated with lung cancer risk in the Chinese.
24120762 Partial unfolding of PR65/A impacts catalysis by altering the proximity of bound catalytic subunit and substrate.
23588898 For PPP2R1A, a heterozygous, somatic mutation (c.771G>T, p.W257C) was identified in 1 out of 37 patients (2.7%) with primary ovarian endometrioid carcinoma.
23555712 gene transcription of PPP2R1A regulated by the polymorphism and methylation in the promoter region
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23267135 This study indicates that the PPP2R1A mutation occurs at a lower frequency compared to other gynecological malignancies, irrespective of the histological subtype
23047923 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21889517 Our findings suggest that functional genetic variants in the proximal promoter of the PP2A-Aalpha gene and their haplotypes are critical in the regulation of transcriptional activation.
21882256 the frequent mutation of PPP2R1A in the serous type of uterine cancer, a low frequency of mutation in endometrioid endometrial cancer and absence of mutation in uterine carcinosarcoma.
21435433 PPP2R1A somatic mutations occur in certain types of uterine and ovarian neoplastic lesions, especially uterine serous carcinomas
21381030 identified somatic missense mutations in 40.8% of high-grade serous endometrial tumours and 5% of endometrial endometrioid carcinomas; mutations identified in ovarian tumours at lower frequencies;no mutations found in high- or low-grade serous carcinoma
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21157432 PP2A-mediated dephosphorylation of Carma1 is a critical step to limit T-cell activation and effector cytokine production.
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20826764 genes mutated in ovarian clear cell carcinoma(OCCC);data suggest PPP2R1A functions as an oncogene and ARID1A as tumor-suppressor gene; in 42 OCCCs, 7% had mutations in PPP2R1A and 57% in ARID1A; suggests aberrant chromatin remodeling contributes to OCCC
20711181 Results demonstrate that PP2A-B55alpha and importin-beta1 cooperate in the regulation of postmitotic assembly mechanisms in human cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19951945 Data show that upon hypoxia, the TGF-beta-induced phosphorylation of Smad3 was inhibited, although Smad2 remained phosphorylated, and Smad3 was dephosphorylated by PP2A.
19890961 Observational study of gene-disease association. (HuGE Navigator)
19794960 Data show that DSB promote PP2A to associate with Ku 70 and Ku 86.
19750005 PP2A-A alpha transcriptional regulation is mediated by multiple factors including AP-2alpha, CREB, ETS-1, and SP-1
18971272 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
17688198 The results of these experiments indicate that the HSF2 region comprising amino acids 343-363 is important for A subunit interaction.
17314097 protein phosphatase 2a recruitment to I-kappaB kinase gamma/NF-kappaB essential modulator is regulated by heptad repeats, which are targeted by HTLV-I tax
17266553 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
17210576 Claspin may be one of the phosphoproteins through which PP2A(Aalpha/Cbeta) affects Chk1 phosphorylation when ATR is activated by human immunodeficiency virus-1 Vpr.
17210576 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
16930554 dysfunction of E-cadherin due to its endocytosis may occur in some proportion of human breast carcinomas in which the PP2A-A protein is lost or significantly reduced
16717086 PP2A-mediated dephosphorylation of BCL-2 is required to protect BCL-2 from proteasome-dependent degradation, affecting resistance to ER stress
14532964 PP2A-A has a role in the failure of beta1 integrin dephosphorylation at threonines 788 and 789 in tumor cell lines
11531413 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9400615 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9013886 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells

AA Sequence

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALA      1 - 70
EQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDW     71 - 140
FTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS    141 - 210
NLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK    211 - 280
TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM    281 - 350
GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR    351 - 420
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMS    421 - 490
GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEV    491 - 560
KPILEKLTQDQDVDVKYFAQEALTVLSLA                                             561 - 589
//

Text Mined References (96)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168268 2015 B56?-related protein phosphatase 2A dysfunction identified in patients with intellectual disability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24885237 2014 Intermittent hypoxia-induced protein phosphatase 2A activation reduces PC12 cell proliferation and differentiation.
24465463 2014 PR65A phosphorylation regulates PP2A complex signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204789 2013 Functional genetic polymorphisms in PP2A subunit genes confer increased risks of lung cancer in southern and eastern Chinese.
24120762 2013 Complex energy landscape of a giant repeat protein.
23588898 2013 Infrequent mutations of the PPP2R1A and PPP2R1B genes in patients with ovarian cancer.
23555712 2013 Role of a novel functional variant in the PPP2R1A promoter on the regulation of PP2A-Aalpha and the risk of hepatocellular carcinoma.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23267135 2013 PPP2R1A mutation is a rare event in ovarian carcinoma across histological subtypes.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21889517 2011 Identification and functional analyses of polymorphism haplotypes of protein phosphatase 2A-A? gene promoter.
21882256 2012 PPP2R1A mutations are common in the serous type of endometrial cancer.
21460856 2011 ATM-mediated phosphorylation activates the tumor-suppressive function of B56?-PP2A.
21435433 2011 Somatic mutations of PPP2R1A in ovarian and uterine carcinomas.
21381030 2011 Subtype-specific mutation of PPP2R1A in endometrial and ovarian carcinomas.
21269460 2011 Initial characterization of the human central proteome.
21157432 2011 Dephosphorylation of Carma1 by PP2A negatively regulates T-cell activation.
21075311 2010 B55?-associated PP2A complex controls PDK1-directed myc signaling and modulates rapamycin sensitivity in colorectal cancer.
20826764 2010 Frequent mutations of chromatin remodeling gene ARID1A in ovarian clear cell carcinoma.
20711181 2010 Live-cell imaging RNAi screen identifies PP2A-B55alpha and importin-beta1 as key mitotic exit regulators in human cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19951945 2010 Hypoxia-activated Smad3-specific dephosphorylation by PP2A.
19890961 2010 Protein phosphatase 2A subunit gene haplotypes and proliferative breast disease modify breast cancer risk.
19794960 2009 A nonhomologous end-joining pathway is required for protein phosphatase 2A promotion of DNA double-strand break repair.
19750005 2009 Transcriptional regulation of PP2A-A alpha is mediated by multiple factors including AP-2alpha, CREB, ETS-1, and SP-1.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19293187 2009 PME-1 protects extracellular signal-regulated kinase pathway activity from protein phosphatase 2A-mediated inactivation in human malignant glioma.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
18394995 2008 Structural mechanism of demethylation and inactivation of protein phosphatase 2A.
17688198 2007 Identification of the PP2A-interacting region of heat shock transcription factor 2.
17632056 2007 CIP2A inhibits PP2A in human malignancies.
17540176 2007 The tumor suppressor PP2A Abeta regulates the RalA GTPase.
17529992 2007 Structural and biochemical insights into the regulation of protein phosphatase 2A by small t antigen of SV40.
17374643 2007 Mechanisms of the HRSL3 tumor suppressor function in ovarian carcinoma cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17314097 2007 Heptad repeats regulate protein phosphatase 2a recruitment to I-kappaB kinase gamma/NF-kappaB essential modulator and are targeted by human T-lymphotropic virus type 1 tax.
17245430 2007 A specific PP2A regulatory subunit, B56gamma, mediates DNA damage-induced dephosphorylation of p53 at Thr55.
17210576 2007 Phosphatase type 2A-dependent and -independent pathways for ATR phosphorylation of Chk1.
17174897 2006 Structure of the protein phosphatase 2A holoenzyme.
17110338 2006 Hsp90 cochaperone Aha1 downregulation rescues misfolding of CFTR in cystic fibrosis.
17055435 2006 Structure of protein phosphatase 2A core enzyme bound to tumor-inducing toxins.
16930554 2006 Induction of E-cadherin endocytosis by loss of protein phosphatase 2A expression in human breast cancers.
16764867 2006 Interaction of nucleoredoxin with protein phosphatase 2A.
16717086 2006 PP2A regulates BCL-2 phosphorylation and proteasome-mediated degradation at the endoplasmic reticulum.
16580887 2006 PP2A is required for centromeric localization of Sgo1 and proper chromosome segregation.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16044149 2005 Activation of the protein kinase B pathway by the HPV-16 E7 oncoprotein occurs through a mechanism involving interaction with PP2A.
15963952 2005 Proteomic analysis of human norepinephrine transporter complexes reveals associations with protein phosphatase 2A anchoring subunit and 14-3-3 proteins.
15936019 2005 Interaction of the protein phosphatase 2A with the regulatory domain of the cystic fibrosis transmembrane conductance regulator channel.
15761952 2005 Single-step Strep-tag purification for the isolation and identification of protein complexes from mammalian cells.
15525651 2004 Galpha12 directly interacts with PP2A: evidence FOR Galpha12-stimulated PP2A phosphatase activity and dephosphorylation of microtubule-associated protein, tau.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14532964 2003 Reduced expression of the regulatory A subunit of serine/threonine protein phosphatase 2A in human breast cancer MCF-7 cells.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12670497 2003 Interaction between protein phosphatase 2A and members of the importin beta superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11856313 2002 Two conserved domains in regulatory B subunits mediate binding to the A subunit of protein phosphatase 2A.
11591705 2001 Protein phosphatase 2A interacts with and directly dephosphorylates RelA.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11504734 2001 Interaction between protein phosphatase 5 and the A subunit of protein phosphatase 2A: evidence for a heterotrimeric form of protein phosphatase 5.
11360189 2001 Absence of PPP2R1A mutations in Wilms tumor.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11007961 2000 Type 2A protein phosphatase, the complex regulator of numerous signaling pathways.
10862698 2000 Proteomic analysis of NMDA receptor-adhesion protein signaling complexes.
10629059 2000 PR48, a novel regulatory subunit of protein phosphatase 2A, interacts with Cdc6 and modulates DNA replication in human cells.
10224043 1999 Regulation of protein phosphatase 2A activity by heat shock transcription factor 2.
9989501 1999 The structure of the protein phosphatase 2A PR65/A subunit reveals the conformation of its 15 tandemly repeated HEAT motifs.
9857076 1998 Identification of structural elements involved in the interaction of simian virus 40 small tumor antigen with protein phosphatase 2A.
9847399 1999 Binding specificity of protein phosphatase 2A core enzyme for regulatory B subunits and T antigens.
9400615 1997 Increasing the ratio of PP2A core enzyme to holoenzyme inhibits Tat-stimulated HIV-1 transcription and virus production.
9013886 1997 Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
8694763 1996 The variable subunit associated with protein phosphatase 2A0 defines a novel multimember family of regulatory subunits.
8617797 1996 Identification of a novel protein phosphatase 2A regulatory subunit highly expressed in muscle.
8254721 1994 Molecular model of the A subunit of protein phosphatase 2A: interaction with other subunits and tumor antigens.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7592815 1995 Identification of a new family of protein phosphatase 2A regulatory subunits.
2554323 1989 Molecular cloning and sequence of cDNA encoding polyoma medium tumor antigen-associated 61-kDa protein.
2159327 1990 alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure.
2157202 1990 Association of protein phosphatase 2A with polyoma virus medium tumor antigen.