Property Summary

NCBI Gene PubMed Count 40
PubMed Score 479.31
PubTator Score 88.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung cancer 4473 3.3e-03
Multiple myeloma 1327 6.7e-03

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.038 6.7e-03
lung cancer 1.300 3.3e-03

Gene RIF (17)

PMID Text
25907536 Data suggest overexpression of NIPP1 in HeLa cells causes induction of genes of mesenchymal lineage with reduction in cell proliferation; thus, key dephosphorylation events may be involved in epithelial-mesenchymal transition or transdifferentiation.
22940584 The molecular basis by which NIPP1 directs PP1 substrate specificity in the nucleus.
22815811 PP1/NIPP1 is a novel molecular compass that controls directed cell migration.
22768081 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
21360054 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
21098020 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
19460752 Knockdown of protein phosphatase 1, regulatory subunit 8 (PPP1R8) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18842582 NIPP1 works as a molecular sensor for PP1 to recognize phosphorylated Sap155.
18253837 NMR structure of the NIPP1 FHA domain.
17804093 NIPP1 is present in a complex with EED and EZH2 in vivo and has distinct binding sites for these proteins.
17724462 Required for the global trimethylation of histone3 at lysine27 and is implicated in gene silencing by enhancer of zeste homolog (EZH)2.
16826568 We demonstrate that interaction with NIPP1 mediates decreased PP1gamma activity in hypoxia, an event which may constitute an inherent part of the cellular oxygen-sensing machinery and may play a role in physiologic adaptation to hypoxia.
16131488 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
16048649 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
15501817 NIPP1 has a role in the nuclear targeting and/or retention of PP1
12788939 PP1 interacts with Tat in part through the binding of Val(36) and Phe(38) of Tat to PP1, and Tat is involved in the nuclear and subnuclear targeting of PP1
11909864 The protein phosphatase-1 regulator NIPP1 is also a splicing factor involved in a late step of spliceosome assembly

AA Sequence

MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRV      1 - 70
HAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD     71 - 140
EKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEII    141 - 210
NPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHG    211 - 280
IHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLL    281 - 350
I//

Text Mined References (47)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25907536 2015 Protein phosphatase PP1-NIPP1 activates mesenchymal genes in HeLa cells.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22940584 2012 The molecular basis for substrate specificity of the nuclear NIPP1:PP1 holoenzyme.
22815811 2012 A role for PP1/NIPP1 in steering migration of human cancer cells.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20516061 2010 Identification and characterization of a novel human PP1 phosphatase complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18842582 2008 Nuclear inhibitor of protein phosphatase-1 (NIPP1) directs protein phosphatase-1 (PP1) to dephosphorylate the U2 small nuclear ribonucleoprotein particle (snRNP) component, spliceosome-associated protein 155 (Sap155).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18253837 2008 The NMR structure of the NIPP1 FHA domain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17804093 The transcriptional repression by NIPP1 is mediated by Polycomb group proteins.
17724462 2008 The transcriptional repressor NIPP1 is an essential player in EZH2-mediated gene silencing.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16826568 2006 Regulation of protein phosphatase 1gamma activity in hypoxia through increased interaction with NIPP1: implications for cellular metabolism.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16216881 2005 Substrate specificity and activity regulation of protein kinase MELK.
15659832 2004 Alternatively spliced protein variants as potential therapeutic targets for male infertility and contraception.
15501817 2004 Interactor-mediated nuclear translocation and retention of protein phosphatase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699119 2004 Inhibition of spliceosome assembly by the cell cycle-regulated protein kinase MELK and involvement of splicing factor NIPP1.
12788942 2003 The protein phosphatase-1 (PP1) regulator, nuclear inhibitor of PP1 (NIPP1), interacts with the polycomb group protein, embryonic ectoderm development (EED), and functions as a transcriptional repressor.
12788939 2003 Nuclear protein phosphatase-1 regulates HIV-1 transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12105215 2002 Phosphorylation-dependent interaction between the splicing factors SAP155 and NIPP1.
11909864 2002 The protein phosphatase-1 regulator NIPP1 is also a splicing factor involved in a late step of spliceosome assembly.
11739654 2001 Dynamic targeting of protein phosphatase 1 within the nuclei of living mammalian cells.
11104670 2000 The C-terminus of NIPP1 (nuclear inhibitor of protein phosphatase-1) contains a novel binding site for protein phosphatase-1 that is controlled by tyrosine phosphorylation and RNA binding.
11034904 2000 Nuclear and subnuclear targeting sequences of the protein phosphatase-1 regulator NIPP1.
10827081 2000 NIPP1-mediated interaction of protein phosphatase-1 with CDC5L, a regulator of pre-mRNA splicing and mitotic entry.
10564811 1999 Alternative splicing regulates the production of ARD-1 endoribonuclease and NIPP-1, an inhibitor of protein phosphatase-1, as isoforms encoded by the same gene.
10432294 1999 Mapping of the RNA-binding and endoribonuclease domains of NIPP1, a nuclear targeting subunit of protein phosphatase 1.
10103062 1999 Organization and alternate splice products of the gene encoding nuclear inhibitor of protein phosphatase-1 (NIPP-1).
9407077 1997 Properties and phosphorylation sites of baculovirus-expressed nuclear inhibitor of protein phosphatase-1 (NIPP-1).
9153239 1997 ARD-1 cDNA from human cells encodes a site-specific single-strand endoribonuclease that functionally resembles Escherichia coli RNase E.
8473324 1993 ARD 1, a 64-kDa guanine nucleotide-binding protein with a carboxyl-terminal ADP-ribosylation factor domain.
7524097 1994 ard-1: a human gene that reverses the effects of temperature-sensitive and deletion mutations in the Escherichia coli rne gene and encodes an activity producing RNase E-like cleavages.
7499293 1995 Molecular cloning of NIPP-1, a nuclear inhibitor of protein phosphatase-1, reveals homology with polypeptides involved in RNA processing.