Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.98
PubTator Score 3.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 3.8e-07
pituitary cancer 1972 9.0e-07
osteosarcoma 7933 9.1e-07
medulloblastoma, large-cell 6234 8.9e-04
colon cancer 1475 1.9e-02
Disease Target Count Z-score Confidence
Lafora disease 9 3.98 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.535 9.1e-07
group 4 medulloblastoma -1.800 3.8e-07
medulloblastoma, large-cell -2.100 8.9e-04
colon cancer 1.400 1.9e-02
pituitary cancer -1.900 9.0e-07

Synonym

Accession O95685 Q6DK02
Symbols PPP1R6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26831516 These data are in accordance with R6 binding directly to AMPKbeta2 when both proteins detach from the diminishing glycogen particle, which is simultaneous with increased AMPKbeta2 Thr-148 autophosphorylation.
26114292 These results define binding to 14-3-3 proteins as an additional pathway in the control of the glycogenic properties of PPP1R3D (R6).
23624058 In this work we present evidence that PPP1R3D (R6), one of the PP1 glycogenic targeting subunits, interacts physically with laforin, a glucan phosphatase involved in Lafora disease, a fatal type of progressive myoclonus epilepsy.

AA Sequence

MSRGPSSAVLPSALGSRKLGPRSLSCLSDLDGGVALEPRACRPPGSPGRAPPPTPAPSGCDPRLRPIILR      1 - 70
RARSLPSSPERRQKAAGAPGAACRPGCSQKLRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSD     71 - 140
LCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDLGISGTVRVCNVAFEKQVAVRYTF    141 - 210
SGWRSTHEAVARWRGPAGPEGTEDVFTFGFPVPPFLLELGSRVHFAVRYQVAGAEYWDNNDHRDYSLTCR    211 - 280
NHALHMPRGECEESWIHFI                                                       281 - 299
//

Text Mined References (12)

PMID Year Title
26831516 2016 The interaction between AMPK?2 and the PP1-targeting subunit R6 is dynamically regulated by intracellular glycogen content.
26114292 2015 Structure-Function Analysis of PPP1R3D, a Protein Phosphatase 1 Targeting Subunit, Reveals a Binding Motif for 14-3-3 Proteins which Regulates its Glycogenic Properties.
23624058 2013 Glycogenic activity of R6, a protein phosphatase 1 regulatory subunit, is modulated by the laforin-malin complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16901901 2006 Laforin, a dual specificity phosphatase that dephosphorylates complex carbohydrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9414128 1997 PPP1R6, a novel member of the family of glycogen-targetting subunits of protein phosphatase 1.
9275233 1997 Spinophilin, a novel protein phosphatase 1 binding protein localized to dendritic spines.