Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.14
PubTator Score 3.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
pituitary cancer 1972 2.8e-07
osteosarcoma 7950 9.1e-07
group 3 medulloblastoma 4104 6.6e-05
medulloblastoma, large-cell 6241 8.9e-04
colon cancer 1478 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Peanut allergy 11 4.011 2.0
Lafora disease 9 3.908 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.400 1.9e-02
group 3 medulloblastoma -1.700 6.6e-05
medulloblastoma, large-cell -2.100 8.9e-04
osteosarcoma -2.535 9.1e-07
pituitary cancer -1.600 2.8e-07

Gene RIF (3)

AA Sequence

MSRGPSSAVLPSALGSRKLGPRSLSCLSDLDGGVALEPRACRPPGSPGRAPPPTPAPSGCDPRLRPIILR      1 - 70
RARSLPSSPERRQKAAGAPGAACRPGCSQKLRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSD     71 - 140
LCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDLGISGTVRVCNVAFEKQVAVRYTF    141 - 210
SGWRSTHEAVARWRGPAGPEGTEDVFTFGFPVPPFLLELGSRVHFAVRYQVAGAEYWDNNDHRDYSLTCR    211 - 280
NHALHMPRGECEESWIHFI                                                       281 - 299
//

Text Mined References (13)

PMID Year Title