Property Summary

NCBI Gene PubMed Count 21
PubMed Score 321.64
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.900 3.1e-03
astrocytoma -1.100 1.9e-02
Astrocytoma, Pilocytic -1.300 6.2e-03
atypical teratoid / rhabdoid tumor -1.700 2.0e-02
Breast cancer -1.200 4.2e-02
colon cancer -3.300 2.0e-07
ependymoma -1.100 2.3e-03
esophageal adenocarcinoma -3.300 1.8e-02
glioblastoma -1.800 3.9e-05
group 3 medulloblastoma -3.500 1.7e-04
interstitial cystitis -1.100 3.3e-03
intraductal papillary-mucinous adenoma (... -2.400 2.0e-05
intraductal papillary-mucinous carcinoma... -1.600 1.1e-02
lung adenocarcinoma -1.300 2.7e-10
lung cancer -2.100 1.5e-05
malignant mesothelioma -4.000 1.5e-09
medulloblastoma, large-cell -3.900 3.3e-04
ovarian cancer -1.600 6.8e-05
pancreatic ductal adenocarcinoma liver m... -2.082 2.2e-02
primitive neuroectodermal tumor -1.700 3.3e-02
psoriasis -1.500 1.8e-06

Synonym

Accession Q9UQK1 B2R7X0 O95686
Symbols PTG
PPP1R5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (6)

AA Sequence

MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKS      1 - 70
QNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQ     71 - 140
PSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGG    141 - 210
TDSDTFSFAIDLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQT    211 - 280
SPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR                                     281 - 317
//

Text Mined References (25)

PMID Year Title