Property Summary

NCBI Gene PubMed Count 20
PubMed Score 288.01
PubTator Score 25.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -4.000 1.5e-09
esophageal adenocarcinoma -3.300 1.8e-02
psoriasis -1.600 4.3e-08
posterior fossa group A ependymoma -1.200 1.2e-03
glioblastoma -2.400 5.7e-04
sonic hedgehog group medulloblastoma -3.600 1.1e-05
astrocytoma -1.100 1.9e-02
atypical teratoid/rhabdoid tumor -2.000 1.1e-03
medulloblastoma, large-cell -3.900 3.3e-04
primitive neuroectodermal tumor -1.700 3.3e-02
pancreatic ductal adenocarcinoma liver m... -2.082 2.2e-02
intraductal papillary-mucinous adenoma (... -2.400 2.0e-05
intraductal papillary-mucinous carcinoma... -1.600 1.1e-02
lung cancer -2.500 1.2e-03
colon cancer -3.300 2.0e-07
interstitial cystitis -1.100 3.3e-03
lung adenocarcinoma -1.300 2.7e-10
adult high grade glioma -1.900 3.1e-03
pilocytic astrocytoma -1.300 5.6e-03
Breast cancer -2.900 5.5e-05
ovarian cancer -1.600 6.8e-05

Synonym

Accession Q9UQK1 B2R7X0 O95686
Symbols PTG
PPP1R5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (9)

Gene RIF (6)

PMID Text
25846879 PPP1R3C, a novel hypermethylated gene in colorectal cancer, may play a critical role in cancer cell growth in association with glucose levels.
24861485 detection of methylation of PPP1R3C alone or in combination with EFHD1 in plasma DNA showed high sensitivity and specificity in CRC detection, and may be useful detection method for CRC, especially for early-stage CRCs.
21738631 Findings suggest that variations in PTG may condition the course of Lafora disease and establish PTG as a potential target for pharmacogenetic and therapeutic approaches.
20888814 Results demonstrated that HIF1 promotes glycogen accumulation through regulating PPP1R3C expression under hypoxia, which revealed a novel metabolic adaptation of cells to hypoxia.
19171932 phosphorylation of R5/PTG at Ser-8 by AMPK accelerates its laforin/malin-dependent ubiquitination and subsequent proteasomal degradation, which results in a decrease of its glycogenic activity.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSCTRMIQVLDPRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKS      1 - 70
QNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDLNDISSALKHHEEKNLILDFPQ     71 - 140
PSTDYLSFRSHFQKNFVCLENCSLQERTVTGTVKVKNVSFEKKVQIRITFDSWKNYTDVDCVYMKNVYGG    141 - 210
TDSDTFSFAIDLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQMAPQDCAFHQT    211 - 280
SPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR                                     281 - 317
//

Text Mined References (24)

PMID Year Title
26519772 2015 Role of glycogen phosphorylase in liver glycogen metabolism.
25846879 2015 The effect of high glucose levels on the hypermethylation of protein phosphatase 1 regulatory subunit 3C (PPP1R3C) gene in colorectal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
24861485 2014 Aberrant promoter methylation of PPP1R3C and EFHD1 in plasma of colorectal cancer patients.
21738631 2011 A PTG variant contributes to a milder phenotype in Lafora disease.
20888814 2010 Hypoxia-inducible factor 1-mediated regulation of PPP1R3C promotes glycogen accumulation in human MCF-7 cells under hypoxia.
19171932 2009 AMP-activated protein kinase phosphorylates R5/PTG, the glycogen targeting subunit of the R5/PTG-protein phosphatase 1 holoenzyme, and accelerates its down-regulation by the laforin-malin complex.
18070875 2008 Malin decreases glycogen accumulation by promoting the degradation of protein targeting to glycogen (PTG).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532330 2003 Laforin, the dual-phosphatase responsible for Lafora disease, interacts with R5 (PTG), a regulatory subunit of protein phosphatase-1 that enhances glycogen accumulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10222257 1999 Protein targeting to glycogen/PPP1R5: screening of coding and flanking genomic regions for polymorphisms and association analysis with insulin action in Pima Indians.
9414128 1997 PPP1R6, a novel member of the family of glycogen-targetting subunits of protein phosphatase 1.
8985175 1996 Amino acid sequence of a novel protein phosphatase 1 binding protein (R5) which is related to the liver- and muscle-specific glycogen binding subunits of protein phosphatase 1.