Property Summary

NCBI Gene PubMed Count 30
PubMed Score 300.91
PubTator Score 15.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute quadriplegic myopathy -1.199 1.3e-04
adrenocortical carcinoma 1.284 1.6e-02
adult high grade glioma 1.300 1.2e-03
aldosterone-producing adenoma -1.286 6.5e-03
Astrocytoma, Pilocytic 1.100 1.4e-04
atypical teratoid / rhabdoid tumor 1.900 1.6e-04
cystic fibrosis 2.091 2.6e-05
ependymoma 1.300 4.8e-05
glioblastoma 1.200 1.6e-03
interstitial cystitis -1.100 3.8e-03
intraductal papillary-mucinous adenoma (... 1.300 9.2e-03
intraductal papillary-mucinous neoplasm ... 1.800 2.1e-02
medulloblastoma, large-cell 1.100 1.8e-04
osteosarcoma 1.645 4.6e-04
ovarian cancer -2.800 2.6e-11
pancreatic cancer 1.200 9.7e-06
pancreatic ductal adenocarcinoma liver m... -1.245 1.3e-02
pituitary cancer -1.200 3.4e-03
psoriasis -1.200 2.4e-09
spina bifida -1.335 3.6e-02
subependymal giant cell astrocytoma 1.792 3.0e-02
tuberculosis -1.500 2.7e-04
ulcerative colitis -1.100 6.8e-06

Gene RIF (8)

AA Sequence

MMAVDIEYRYNCMAPSLRQERFAFKISPKPSKPLRPCIQLSSKNEASGMVAPAVQEKKVKKRVSFADNQG      1 - 70
LALTMVKVFSEFDDPLDMPFNITELLDNIVSLTTAESESFVLDFSQPSADYLDFRNRLQADHVCLENCVL     71 - 140
KDKAIAGTVKVQNLAFEKTVKIRMTFDTWKSYTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEF    141 - 210
AVYYECNGQTYWDSNRGKNYRIIRAELKSTQGMTKPHSGPDLGISFDQFGSPRCSYGLFPEWPSYLGYEK    211 - 280
LGPYY                                                                     281 - 285
//

Text Mined References (32)

PMID Year Title