Property Summary

NCBI Gene PubMed Count 27
PubMed Score 22.95
PubTator Score 186.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Gene RIF (17)

PMID Text
23359326 results demonstrate that hScrib acts as a scaffold to integrate the control of the PP1gamma and ERK signaling pathways and explains how disruption of hScrib localisation can contribute towards the development of human malignancy
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19056482 Observational study of gene-disease association. (HuGE Navigator)
18232732 PPP1R3A C1984DeltaAG (stop codon 668) isthe 1st prevalent mutation that directly impairs glycogen synthesis & decreases glycogen levels in human skeletal muscle. It is present in approximately 1 in 70 UK whites.
16276364 Observational study of gene-disease association. (HuGE Navigator)
15870946 Observational study of gene-disease association. (HuGE Navigator)
15870946 Inactivation of PPP1R3 gene is associated with tumor progression and metastasis of colorectal cancers
15231141 Observational study of gene-disease association. (HuGE Navigator)
15181086 Observational study of gene-disease association. (HuGE Navigator)
15181086 Among the largest cohort of nondiabetic subjects (Caucasian, n = 112), the presence of the deletion allele (ARE-2) was associated with insulin resistance and hyperandrogenemia.
14767904 Observational study of gene-disease association. (HuGE Navigator)
12941760 G(M) promotes glycogen storage and inversely regulates glycogen synthase and glycogen phosphorylase activities, while, specifically, synthase phosphatase activity of G(M)-PP1 is inhibited by glycogen.
12185156 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12118251 We describe a family in which five individuals with severe insulin resistance, but no unaffected family members, were compound heterozygous with respect to frameshift/premature stop mutations in two unlinked genes, PPARG and PPP1R3A
11793847 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11793847 A joint effect between the Asp905 and BMI increases the risk of type 2 diabetes, and Asp905Tyr and ARE polymorphism of PPP1R3 gene are not the major diabetogenic gene variants in Chinese population.
11512679 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEDIYLDTPSSGTRRVSFADSF      1 - 70
GFNLVSVKEFDCWELPSASTTFDLGTDIFHTEEYVLAPLFDLPSSKEDLMQQLQIQKAILESTESLLGST     71 - 140
SIKGIIRVLNVSFEKLVYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKIVLVPPYQKDGSKVEFCIR    141 - 210
YETSVGTFWSNNNGTNYTFICQKKEQEPEPVKPWKEVPNRQIKGCLKVKSSKEESSVTSEENNFENPKNT    211 - 280
DTYIPTIICSHEDKEDLEASNRNVKDVNREHDEHNEKELELMINQHLIRTRSTASRDERNTFSTDPVNFP    281 - 350
NKAEGLEKKQIHGEICTDLFQRSLSPSSSAESSVKGDFYCNEKYSSGDDCTHQPSEETTSNMGEIKPSLG    351 - 420
DTSSDELVQLHTGSKEVLDDNANPAHGNGTVQIPCPSSDQLMAGNLNKKHEGGAKNIEVKDLGCLRRDFH    421 - 490
SDTSACLKESTEEGSSKEDYYGNGKDDEEQRIYLGVNEKQRKNFQTILHDQERKMGNPKISVAGIGASNR    491 - 560
DLATLLSEHTAIPTRAITADVSHSPRTNLSWEEAVLTPEHHHLTSEGSALGGITGQVCSSRTGNVLRNDY    561 - 630
LFQVEEKSGGINSEDQDNSPQHKQSWNVLESQGKSRENKTNITEHIKGQTDCEDVWGKRDNTRSLKATTE    631 - 700
ELFTCQETVCCELSSLADHGITEKAEAGTAYIIKTTSESTPESMSAREKAIIAKLPQETARSDRPIEVKE    701 - 770
TAFDPHEGRNDDSHYTLCQRDTVGVIYDNDFEKESRLGICNVRVDEMEKEETMSMYNPRKTHDREKCGTG    771 - 840
NITSVEESSWVITEYQKATSKLDLQLGMLPTDKTVFSENRDLRQVQELSKKTDSDAIVHSAFNSDTNRAP    841 - 910
QNSSPFSKHHTEISVSTNEQAIAVENAVTTMASQPISTKSENICNSTREIQGIEKHPYPESKPEEVSRSS    911 - 980
GIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSA    981 - 1050
STSLPVEESQAQGNESLFSKYTNSKIPYFLLFLIFLITVYHYDLMIGLTFYVLSLSWLSWEEGRQKESVK   1051 - 1120
KK                                                                       1121 - 1122
//

Text Mined References (28)

PMID Year Title
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
23359326 2013 A novel interaction between hScrib and PP1? downregulates ERK signaling and suppresses oncogene-induced cell transformation.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19056482 2009 Association of a polymorphism of the apolipoprotein E gene with chronic kidney disease in Japanese individuals with metabolic syndrome.
18232732 2008 A prevalent variant in PPP1R3A impairs glycogen synthesis and reduces muscle glycogen content in humans and mice.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16276364 2006 Clinical and genetic associations with hypertriglyceridemic waist in a Canadian aboriginal population.
15870946 2005 PPP1R3 gene (protein phosphatase 1) alterations in colorectal cancer and its relationship to metastasis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231141 2004 [Study on the association of PPP1R3 gene polymorphism with type 2 diabetes in Han population of Anhui province].
15181086 2004 Association of the (AU)AT-rich element polymorphism in PPP1R3 with hormonal and metabolic features of polycystic ovary syndrome.
14767904 2004 [Study on association of PPP1R3 gene 5 bp deletion/insertion within 3'-untranslated region polymorphism with type 2 diabetes].
12941760 2003 Regulation and function of the muscle glycogen-targeting subunit of protein phosphatase 1 (GM) in human muscle cells depends on the COOH-terminal region and glycogen content.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185156 2002 Genetic variability in the insulin signalling pathway may contribute to the risk of late onset Alzheimer's disease.
12118251 2002 Digenic inheritance of severe insulin resistance in a human pedigree.
11793847 2001 The association between PPP1R3 gene polymorphisms and type 2 diabetes mellitus.
11512679 2001 Allele frequencies for candidate genes in atherosclerosis and diabetes among Trinidadian neonates.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10648825 2000 Phosphorylation of the skeletal muscle glycogen-targetting subunit of protein phosphatase 1 in response to adrenaline in vivo.
9845327 1998 Biophysical interaction between phospholamban and protein phosphatase 1 regulatory subunit GM.
9726244 1998 A common variant in PPP1R3 associated with insulin resistance and type 2 diabetes.
7926294 1994 Sequence of the human glycogen-associated regulatory subunit of type 1 protein phosphatase and analysis of its coding region and mRNA level in muscle from patients with NIDDM.
7581368 1995 A widespread amino acid polymorphism at codon 905 of the glycogen-associated regulatory subunit of protein phosphatase-1 is associated with insulin resistance and hypersecretion of insulin.
2558013 1989 Regulation of protein phosphatase-1G from rabbit skeletal muscle. 1. Phosphorylation by cAMP-dependent protein kinase at site 2 releases catalytic subunit from the glycogen-bound holoenzyme.