Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
posterior fossa group B ependymoma 416 6.4e-05
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.572 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.200 6.4e-05

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MMGKLPLGVVSPYVKMSSGGYTDPLKFYATSYCTAYGREDFKPRVGSHVGTGYKSNFQPVVSCQASLEAL      1 - 70
DNPARGEQAQDHFQSVASQSYRPLEVPDGKHPLPWSMRQTSSGYGREKPSAGPPTKEVRKVHFDTQEHGP     71 - 140
QAITGLEPREVPLLHQQQGQDPLERENFRHGPRFMTSEYNSKYLRDPLDQPDFLQKKSIGAKEGSGFTKQ    141 - 210
SHQSPIVFQPPSQALPGDPALLPGQSVTKSDFLPKTHLHGDEFLPVLARGSKRETAFSRGNERILNPRVP    211 - 280
PPCPEPSSVSHQQFQPLHRMQQTNVALLGRETVGKKEPTGFSLNNPMYVRSPCDPDRDQRYLTTYNQGYF    281 - 350
ENIPKGLDQEGWTRGGIQPQMPGGYALSQPVSCMEATPNPMESLRHLHPHVGRTLTSADPFYQNTPHSSR    351 - 420
CVAHS                                                                     421 - 425
//

Text Mined References (7)

PMID Year Title