Property Summary

NCBI Gene PubMed Count 31
PubMed Score 25.57
PubTator Score 63.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.501 2.1e-03
atypical teratoid / rhabdoid tumor -1.200 1.4e-04
medulloblastoma -1.200 1.1e-03
medulloblastoma, large-cell -1.200 8.1e-03
pancreatic ductal adenocarcinoma liver m... 1.429 4.9e-03
tuberculosis and treatment for 6 months 1.100 3.9e-06
Pick disease 1.300 5.6e-06
gastric carcinoma 1.100 1.3e-02
ovarian cancer -1.600 1.1e-06

Gene RIF (10)

PMID Text
24195737 The results show that contrary to initial observations PPP1R2-related pseudogenes are not simple bystanders of the evolutionary process but may rather be at the origin of genes with novel functions.
23506001 The potential phosphosites in PPP1R2 are substituted by non-phosphorylable residues, T73P and S87R, in PPP1R2P3.
21714498 Pin1 and phosphatase inhibitor-2 are conserved among eukaryotes from yeast to humans and make an ancient partnership that provides a means for regulating Pin1 specificity and function.
19036150 Results suggest that phosphatase inhibitor 2 localizes to the primary cilium of human retinal epithelial cells where it affects both Ser/Thr phosphorylation and is required for full tubulin acetylation.
18716057 Conserved together throughout eukaryotic evolution, I-2, PP1 and Aurora B function interdependently during mitosis.
16987514 These results indicate that the protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation induced by KCl and that GSK3 activity regulates SERCA2 levels.
16627625 Studies in hamster indicate that modulation of type 1 protein phosphatase (PP1) activity by inhibitor-2 (INH-2) provides a potential new treatment for heart failure without activating protein kinase A (PKA) signaling.
12761178 first demonstration that glycogen synthase kinase-3beta associates with PP1C/I-2 complex and phosphorylates I-2 at T72 in intact cells
12393858 PP1C and Inh2 bind to KPI2 to form a regulatory complex that is localized to membranes
12221103 Inh2 can enhance the kinase activity of the Nek2.PP1C complex via inhibition of phosphatase activity to initiate centrosome separation

AA Sequence

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDE      1 - 70
PSTPYHSMMGDDEDACSDTEATEAMAPDILARKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMKRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS         141 - 205
//

Text Mined References (37)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24195737 2013 Not so pseudo: the evolutionary history of protein phosphatase 1 regulatory subunit 2 and related pseudogenes.
23506001 2013 Identification and characterization of two distinct PPP1R2 isoforms in human spermatozoa.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
21714498 2011 Molecular basis for an ancient partnership between prolyl isomerase Pin1 and phosphatase inhibitor-2.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19036150 2008 Phosphatase inhibitor 2 promotes acetylation of tubulin in the primary cilium of human retinal epithelial cells.
18716057 2008 Phosphatase inhibitor-2 balances protein phosphatase 1 and aurora B kinase for chromosome segregation and cytokinesis in human retinal epithelial cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18250156 2008 A novel ATM-dependent pathway regulates protein phosphatase 1 in response to DNA damage.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16987514 2006 The protein phosphatase-1/inhibitor-2 complex differentially regulates GSK3 dephosphorylation and increases sarcoplasmic/endoplasmic reticulum calcium ATPase 2 levels.
16627625 2006 Inhibition of protein phosphatase 1 by inhibitor-2 gene delivery ameliorates heart failure progression in genetic cardiomyopathy.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12761178 2003 Regulation of type 1 protein phosphatase/inhibitor-2 complex by glycogen synthase kinase-3beta in intact cells.
12697755 2003 Phosphorylation of phosphatase inhibitor-2 at centrosomes during mitosis.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393858 2002 A novel transmembrane Ser/Thr kinase complexes with protein phosphatase-1 and inhibitor-2.
12270929 2002 Neurabins recruit protein phosphatase-1 and inhibitor-2 to the actin cytoskeleton.
12221103 2002 Inhibitor-2 regulates protein phosphatase-1 complexed with NimA-related kinase to induce centrosome separation.
11320080 2001 Neuronal Cdc2-like protein kinase (Cdk5/p25) is associated with protein phosphatase 1 and phosphorylates inhibitor-2.
10807923 2000 Interaction of inhibitor-2 with the catalytic subunit of type 1 protein phosphatase. Identification of a sequence analogous to the consensus type 1 protein phosphatase-binding motif.
9405437 1997 Multisite phosphorylation and the nuclear localization of phosphatase inhibitor 2-green fluorescent protein fusion protein during S phase of the cell growth cycle.
9126490 1997 Genetic analysis of human type 1 protein phosphatase inhibitor 2 in insulin-resistant Pima Indians.
8288648 1994 Molecular mechanism of the synergistic phosphorylation of phosphatase inhibitor-2. Cloning, expression, and site-directed mutagenesis of inhibitor-2.
8119416 1994 Cloning of the complete coding region for human protein phosphatase inhibitor 2 using the two hybrid system and expression of inhibitor 2 in E. coli.
7949733 1994 Cloning and characterization of human phosphatase inhibitor-2 (IPP-2) sequences.