Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.68
PubTator Score 9.04

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 9.8e-04
medulloblastoma, large-cell 1.300 1.1e-04
adult high grade glioma 1.800 1.6e-04
ovarian cancer 1.300 3.3e-08
pituitary cancer 1.300 3.0e-03

Gene RIF (6)

PMID Text
25339026 IPP5 mutations are associated with response to paclitaxel in cervical cancer.
24935604 The data demonstrate a novel role for 8-60hIPP5(m) in the control of G2/M cell cycle progression, a process that involves the activation of ATM/p53/p21cip1/waf1/Cdc2/ cyclin B1 pathways.
22939397 The effect of IPP5 on tumor growth and the underlying molecular mechanisms were investigated by overexpression of IPP5 in HeLa cells, a human cervical carcinoma cell line.
20468071 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19874272 Overexpression of active mutant IPP5 inhibited anchorage-dependent growth and induced apoptosis in HeLa cells, which may be attributed to the up-regulation of p21, p53 and Bcl-2-antagonist/killer, and down-regulation of Bcl-2 and Bcl-X(L).

AA Sequence

MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRK      1 - 70
QSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH                                    71 - 109
//

Text Mined References (13)

PMID Year Title
25339026 2014 Sensitization of cervical carcinoma cells to paclitaxel by an IPP5 active mutant.
24935604 2014 8-60hIPP5(m)-induced G2/M cell cycle arrest involves activation of ATM/p53/p21(cip1/waf1) pathways and delayed cyclin B1 nuclear translocation.
22939397 2012 IPP5, a novel inhibitor of protein phosphatase 1, suppresses tumor growth and progression of cervical carcinoma cells by inducing G2/M arrest.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19874272 2009 Effect of IPP5, a novel inhibitor of PP1, on apoptosis and the underlying mechanisms involved.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18310074 2008 IPP5, a novel protein inhibitor of protein phosphatase 1, promotes G1/S progression in a Thr-40-dependent manner.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.