Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.17
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma 1.500 4.1e-11
Duchenne muscular dystrophy -1.078 1.5e-04
Becker muscular dystrophy -1.038 3.9e-02
interstitial cystitis -1.300 2.4e-03
lung adenocarcinoma 1.100 5.9e-07
Breast cancer 1.200 3.1e-05

Gene RIF (2)

PMID Text
21509594 PPP1R16A gene expression is decreased in follicular variant of papillary thyroid carcinoma.
16920702 analysis of a novel mechanism for the phosphorylation of MYPT3 by PKA and activation of the catalytic activity through direct interaction of a central region of MYPT3 with its N-terminal region

AA Sequence

MAEHLELLAEMPMVGRMSTQERLKHAQKRRAQQVKMWAQAEKEAQGKKGPGERPRKEAASQGLLKQVLFP      1 - 70
PSVVLLEAAARNDLEEVRQFLGSGVSPDLANEDGLTALHQCCIDDFREMVQQLLEAGANINACDSECWTP     71 - 140
LHAAATCGHLHLVELLIASGANLLAVNTDGNMPYDLCDDEQTLDCLETAMADRGITQDSIEAARAVPELR    141 - 210
MLDDIRSRLQAGADLHAPLDHGATLLHVAAANGFSEAAALLLEHRASLSAKDQDGWEPLHAAAYWGQVPL    211 - 280
VELLVAHGADLNAKSLMDETPLDVCGDEEVRAKLLELKHKHDALLRAQSRQRSLLRRRTSSAGSRGKVVR    281 - 350
RVSLTQRTDLYRKQHAQEAIVWQQPPPTSPEPPEDNDDRQTGAELRPPPPEEDNPEVVRPHNGRVGGSPV    351 - 420
RHLYSKRLDRSVSYQLSPLDSTTPHTLVHDKAHHTLADLKRQRAAAKLQRPPPEGPESPETAEPGLPGDT    421 - 490
VTPQPDCGFRAGGDPPLLKLTAPAVEAPVERRPCCLLM                                    491 - 528
//

Text Mined References (18)

PMID Year Title
26401656 2015 Integration of Genome-Wide SNP Data and Gene-Expression Profiles Reveals Six Novel Loci and Regulatory Mechanisms for Amino Acids and Acylcarnitines in Whole Blood.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21712390 2011 Ornithine decarboxylase antizyme Oaz3 modulates protein phosphatase activity.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21509594 2011 Differential expression of a set of genes in follicular and classic variants of papillary thyroid carcinoma.
19060904 2009 An empirical framework for binary interactome mapping.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16920702 2006 Phosphorylation of myosin phosphatase targeting subunit 3 (MYPT3) and regulation of protein phosphatase 1 by protein kinase A.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.
11336659 2001 Cloning and identification of MYPT3: a prenylatable myosin targetting subunit of protein phosphatase 1.