Property Summary

NCBI Gene PubMed Count 53
PubMed Score 136.44
PubTator Score 81.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease -1.451 2.3e-02
acute myeloid leukemia 2.200 7.0e-03
aldosterone-producing adenoma -1.063 2.4e-02
Bipolar Disorder 1.388 4.0e-02
COPD -1.100 2.4e-02
diabetes mellitus -1.200 1.4e-02
gastric carcinoma 1.200 1.6e-02
invasive ductal carcinoma -1.114 4.7e-02
lung adenocarcinoma -1.200 2.0e-15
lung cancer -1.800 6.7e-05
lung carcinoma -2.100 6.3e-18
Multiple myeloma 1.494 6.1e-03
non-small cell lung cancer -2.019 2.6e-21
pancreatic cancer 1.200 2.7e-02
pituitary cancer -1.500 8.3e-04
psoriasis -1.200 1.8e-06
tuberculosis -1.200 2.4e-03

Protein-protein Interaction (7)

Gene RIF (33)

AA Sequence

MAPGQAPHQATPWRDAHPFFLLSPVMGLLSRAWSRLRGLGPLEPWLVEAVKGAALVEAGLEGEARTPLAI      1 - 70
PHTPWGRRPEEEAEDSGGPGEDRETLGLKTSSSLPEAWGLLDDDDGMYGEREATSVPRGQGSQFADGQRA     71 - 140
PLSPSLLIRTLQGSDKNPGEEKAEEEGVAEEEGVNKFSYPPSHRECCPAVEEEDDEEAVKKEAHRTSTSA    141 - 210
LSPGSKPSTWVSCPGEEENQATEDKRTERSKGARKTSVSPRSSGSDPRSWEYRSGEASEEKEEKAHKETG    211 - 280
KGEAAPGPQSSAPAQRPQLKSWWCQPSDEEEGEVKALGAAEKDGEAECPPCIPPPSAFLKAWVYWPGEDT    281 - 350
EEEEDEEEDEDSDSGSDEEEGEAEASSSTPATGVFLKSWVYQPGEDTEEEEDEDSDTGSAEDEREAETSA    351 - 420
STPPASAFLKAWVYRPGEDTEEEEDEDVDSEDKEDDSEAALGEAESDPHPSHPDQRAHFRGWGYRPGKET    421 - 490
EEEEAAEDWGEAEPCPFRVAIYVPGEKPPPPWAPPRLPLRLQRRLKRPETPTHDPDPETPLKARKVRFSE    491 - 560
KVTVHFLAVWAGPAQAARQGPWEQLARDRSRFARRITQAQEELSPCLTPAARARAWARLRNPPLAPIPAL    561 - 630
TQTLPSSSVPSSPVQTTPLSQAVATPSRSSAAAAAALDLSGRRG                              631 - 674
//

Text Mined References (58)

PMID Year Title