Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.69
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer -1.700 1.3e-05
intraductal papillary-mucinous neoplasm ... 1.700 2.6e-03
ovarian cancer 1.100 7.8e-11

Gene RIF (2)

AA Sequence

MLSSSPASCTSPSPDGENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWL      1 - 70
EMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCPRPTEAFISELLSQLKKLRRL     71 - 140
SRPQK                                                                     141 - 145
//

Text Mined References (5)

PMID Year Title