Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.89
PubTator Score 41.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.100 1.1e-03
osteosarcoma 1.650 6.9e-03
medulloblastoma -1.900 8.2e-03
atypical teratoid / rhabdoid tumor -1.700 1.5e-06
medulloblastoma, large-cell -2.400 1.2e-05
Pick disease -1.100 9.4e-03
Breast cancer -2.600 2.3e-08
ulcerative colitis -1.400 6.7e-03
ovarian cancer 1.900 2.1e-05
chronic rhinosinusitis -1.669 2.3e-02
facioscapulohumeral dystrophy 2.200 4.7e-03

Gene RIF (5)

PMID Text
20592344 analysis of antibodies generated against the protein phosphatase 1 inhibitor KEPI and characterization of the epitope
19475667 Observational study of gene-disease association. (HuGE Navigator)
19132087 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
11812771 regulation by morphine
11812771 PPP1R14C gene encodes a PKC-potentiated inhibitory protein, KEPI, for type-1 Ser/Thr protein phosphatase (PP1). KEPI mRNA and protein were enriched in brain, heart and skeletal muscle.

AA Sequence

MSVATGSSETAGGASGGGARVFFQSPRGGAGGSPGSSSGSGSSREDSAPVATAAAAGQVQQQQQRRHQQG      1 - 70
KVTVKYDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPEVEIDIDDLLDADSDEERASKLQEALVDCYKPT     71 - 140
EEFIKELLSRIRGMRKLSPPQKKSV                                                 141 - 165
//

Text Mined References (18)

PMID Year Title
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21269460 2011 Initial characterization of the human central proteome.
20592344 2010 Generation of an antibody against the protein phosphatase 1 inhibitor KEPI and characterization of the epitope.
19475667 2009 SNCA variants are associated with increased risk for multiple system atrophy.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19132087 2009 A genome-wide association study identifies novel and functionally related susceptibility Loci for Kawasaki disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12804574 2003 Phosphorylation of protein phosphatase type-1 inhibitory proteins by integrin-linked kinase and cyclic nucleotide-dependent protein kinases.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.
11812771 2002 KEPI, a PKC-dependent protein phosphatase 1 inhibitor regulated by morphine.
11564868 2001 Growth arrest and DNA damage-inducible protein GADD34 assembles a novel signaling complex containing protein phosphatase 1 and inhibitor 1.