Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.58
PubTator Score 118.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
lung adenocarcinoma 2714 1.4e-13
Breast cancer 3098 5.5e-06
breast carcinoma 1614 1.2e-04
Disease Target Count Z-score Confidence
Ovarian clear cell carcinoma 1 3.545 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.900 1.2e-04
lung adenocarcinoma 1.800 1.4e-13
Breast cancer 1.400 5.5e-06

Synonym

Accession Q96C90 Q504S7 Q7KZD7
Symbols PNG
PHI-1
PLCB3N
SOM172

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15522888 PHI-1 participates in regulatory events at the trailing edge of migrating cells and modulates retraction of endothelial and epithelial cells
15083373 Whereas CPI-17 staining was diffuse, PHI-1 was concentrated along the cell membrane in distinct foci. The common tissue distribution but different cellular localization of PHI-1 and CPI-17 suggest distinctive physiological roles for these PP1 inhibitors.
10606530 An inhibitory phosphoprotein that inhibits the myosin- and glycogen-associated holoenzyme versions of protein type-1 phosphatase (PP1) as well as the monomeric catalytic subunit of PP1 in multiple tissues.

AA Sequence

MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLN      1 - 70
LEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQK     71 - 140
LSTPQKK                                                                   141 - 147
//

Text Mined References (19)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16341674 2005 Transcriptome analysis of human gastric cancer.
15522888 2004 Migration and retraction of endothelial and epithelial cells require PHI-1, a specific protein-phosphatase-1 inhibitor protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15083373 2004 Juxtamembrane localization of the protein phosphatase-1 inhibitor protein PHI-1 in smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10606530 1999 A novel phosphoprotein inhibitor of protein type-1 phosphatase holoenzymes.
8838322 1996 Isolation and characterization of a novel gene close to the human phosphoinositide-specific phospholipase C beta 3 gene on chromosomal region 11q13.