Property Summary

NCBI Gene PubMed Count 11
PubMed Score 17.57
PubTator Score 118.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 1.4e-13
Breast cancer 3578 5.5e-06
breast carcinoma 1638 1.2e-04
Disease Target Count Z-score Confidence
Ovarian clear cell carcinoma 2 3.41 1.7
Western equine encephalitis 13 3.035 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer 1.400 5.5e-06
breast carcinoma 1.900 1.2e-04
lung adenocarcinoma 1.800 1.4e-13

Gene RIF (5)

AA Sequence

MADSGTAGGAALAAPAPGPGSGGPGPRVYFQSPPGAAGEGPGGADDEGPVRRQGKVTVKYDRKELRKRLN      1 - 70
LEEWILEQLTRLYDCQEEEIPELEIDVDELLDMESDDARAARVKELLVDCYKPTEAFISGLLDKIRGMQK     71 - 140
LSTPQKK                                                                   141 - 147
//

Text Mined References (19)

PMID Year Title