Property Summary

NCBI Gene PubMed Count 25
PubMed Score 324.93
PubTator Score 53.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease -1.151 1.1e-02
active ulcerative colitis -1.156 6.7e-03
astrocytoma -1.100 3.1e-04
atypical teratoid / rhabdoid tumor -1.600 7.1e-03
Breast cancer 1.300 2.9e-02
breast carcinoma -1.900 3.7e-31
chronic lymphosyte leukemia -1.300 8.1e-08
cystic fibrosis -1.918 1.9e-05
ductal carcinoma in situ -2.300 5.5e-05
ependymoma -3.100 3.1e-02
group 4 medulloblastoma -3.400 2.6e-04
intraductal papillary-mucinous adenoma (... -2.000 9.6e-05
intraductal papillary-mucinous carcinoma... -2.000 1.7e-04
intraductal papillary-mucinous neoplasm ... -2.100 2.1e-03
invasive ductal carcinoma -3.300 1.4e-04
non-small cell lung cancer -2.682 4.7e-29
oligodendroglioma -1.500 1.3e-05
osteosarcoma -2.152 3.7e-02
ovarian cancer 1.300 2.9e-02
pediatric high grade glioma -1.800 7.0e-03
progressive supranuclear palsy -1.400 2.2e-02
psoriasis -1.100 9.5e-05
subependymal giant cell astrocytoma -3.464 5.5e-03

Gene RIF (15)

AA Sequence

MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRLEELYRGMEAD      1 - 70
MPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLSPLQD     71 - 140
RARTAHP                                                                   141 - 147
//

Text Mined References (30)

PMID Year Title