Property Summary

NCBI Gene PubMed Count 95
PubMed Score 64.54
PubTator Score 67.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active ulcerative colitis 1.028 1.2e-02
aldosterone-producing adenoma -1.040 9.0e-03
colon cancer 1.100 2.9e-03
cutaneous lupus erythematosus -1.400 1.4e-02
esophageal adenocarcinoma -1.500 3.0e-02
interstitial cystitis -1.400 1.9e-03
malignant mesothelioma 2.500 2.0e-08
pancreatic ductal adenocarcinoma liver m... 1.216 1.2e-02
pituitary cancer -1.100 5.7e-07
posterior fossa group A ependymoma 1.200 4.4e-06
spina bifida -2.020 3.3e-02

Gene RIF (80)

AA Sequence

MDSEAFQSARDFLDMNFQSLAMKHMDLKQMELDTAAAKVDELTKQLESLWSDSPAPPGPQAGPPSRPPRY      1 - 70
SSSSIPEPFGSRGSPRKAATDGADTPFGRSESAPTLHPYSPLSPKGRPSSPRTPLYLQPDAYGSLDRATS     71 - 140
PRPRAFDGAGSSLGRAPSPRPGPGPLRQQGPPTPFDFLGRAGSPRGSPLAEGPQAFFPERGPSPRPPATA    141 - 210
YDAPASAFGSSLLGSGGSAFAPPLRAQDDLTLRRRPPKAWNESDLDVAYEKKPSQTASYERLDVFARPAS    211 - 280
PSLQLLPWRESSLDGLGGTGKDNLTSATLPRNYKVSPLASDRRSDAGSYRRSLGSAGPSGTLPRSWQPVS    281 - 350
RIPMPPSSPQPRGAPRQRPIPLSMIFKLQNAFWEHGASRAMLPGSPLFTRAPPPKLQPQPQPQPQPQSQP    351 - 420
QPQLPPQPQTQPQTPTPAPQHPQQTWPPVNEGPPKPPTELEPEPEIEGLLTPVLEAGDVDEGPVARPLSP    421 - 490
TRLQPALPPEAQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRLFHRHGGPGPG    491 - 560
GPEPELSPITEGSEARAGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMRSVLRKAGSPRKARRARLNPLVL    561 - 630
LLDAALTGELEVVQQAVKEMNDPSQPNEEGITALHNAICGANYSIVDFLITAGANVNSPDSHGWTPLHCA    631 - 700
ASCNDTVICMALVQHGAAIFATTLSDGATAFEKCDPYREGYADCATYLADVEQSMGLMNSGAVYALWDYS    701 - 770
AEFGDELSFREGESVTVLRRDGPEETDWWWAALHGQEGYVPRNYFGLFPRVKPQRSKV                771 - 828
//

Text Mined References (104)

PMID Year Title