Property Summary

NCBI Gene PubMed Count 38
PubMed Score 19.34
PubTator Score 22.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.400 8.6e-07
astrocytic glioma -1.100 1.2e-02
Astrocytoma, Pilocytic -1.800 3.4e-08
atypical teratoid / rhabdoid tumor -2.400 1.9e-10
ependymoma -1.600 5.1e-10
glioblastoma -2.000 3.0e-08
lung cancer -1.300 1.5e-03
malignant mesothelioma -1.100 2.4e-06
medulloblastoma -1.500 2.2e-04
medulloblastoma, large-cell -2.500 7.0e-05
osteosarcoma -1.534 4.7e-04
primitive neuroectodermal tumor -1.800 6.5e-04
psoriasis -1.300 8.0e-04

Gene RIF (22)

AA Sequence

MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDHMMYEHLQKWG      1 - 70
PRREEVKFFLRHEDSPTENSEQGGRQTQEQRTQRNVINVPGEKRTENGVGNPRVELTLSELQDMAARQQQ     71 - 140
QIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLKERVEAQENKLKKIRAMRGQVDYSKIMNGNL    141 - 210
SAEIERFSAMFQEKKQEVQTAILRVDQLSQQLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQ    211 - 280
LNQEQNSKLQQQKELLNKRNMEVAMMDKRISELRERLYGKKIQLNRVNGTSSPQSPLSTSGRVAAVGPYI    281 - 350
QVPSAGSFPVLGDPIKPQSLSIASNAAHGRSKSANDGNWPTLKQNSSSSVKPVQVAGADWKDPSVEGSVK    351 - 420
QGTVSSQPVPFSALGPTEKPGIEIGKVPPPIPGVGKQLPPSYGTYPSPTPLGPGSTSSLERRKEGSLPRP    421 - 490
SAGLPSRQRPTLLPATGSTPQPGSSQQIQQRISVPPSPTYPPAGPPAFPAGDSKPELPLTVAIRPFLADK    491 - 560
GSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAAHSALNKSVKAVYGKPVLPSGSTSPSPLPFLHGS    561 - 630
LSTGTPQPQPPSESTEKEPEQDGPAAPADGSTVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLAN    631 - 700
APRPLKKRSSITEPEGPGGPNIQKLLYQRFNTLAGGMEGTPFYQPSPSQDFMGTLADVDNGNTNANGNLE    701 - 770
ELPPAQPTAPLPAEPAPSSDANDNELPSPEPEELICPQTTHQTAEPAEDNNNNVATVPTTEQIPSPVAEA    771 - 840
PSPGEEQVPPAPLPPASHPPATSTNKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGEFDLVQRIIYE    841 - 910
VEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKQLVESGAAI    911 - 980
FASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKGVAYALWDYEAQNSDELSFHEGDALTILR    981 - 1050
RKDESETEWWWARLGDREGYVPKNLLGLYPRIKPRQRTLA                                 1051 - 1090
//

Text Mined References (43)

PMID Year Title