Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.22
PubTator Score 17.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.131 1.9e-04
non primary Sjogren syndrome sicca 1.200 1.8e-02
acute myeloid leukemia 1.100 1.7e-02
ovarian cancer 1.400 7.0e-04

Synonym

Accession O60927
Symbols HCGV
IPP3
HCG-V
TCTE5
TCTEX5
CFAP255

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
25298395 a model in which I3 regulates an SDS22-mediated PP1 activation step in solution that precedes SDS22 dissociation and transfer of PP1 to kinetochores, and which is required for PP1 to efficiently antagonize Aurora B.
19851445 Observational study of gene-disease association. (HuGE Navigator)
18951879 Inh3 has two domains that are required for its interaction with PP1.
18450750 inhibitor-3 is an in vivo target of caspase-3 and participates in the apoptotic response
17630778 Sds22 and Inhibitor-3 form a heterotrimeric complex with PP1, both in cell lysates and after purification. A pool of PP1 is complexly controlled by both Sds22 and Inhibitor-3.

AA Sequence

MAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAF      1 - 70
GESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH                   71 - 126
//

Text Mined References (28)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25298395 2014 Inhibitor-3 ensures bipolar mitotic spindle attachment by limiting association of SDS22 with kinetochore-bound protein phosphatase-1.
24489884 2014 Genome-wide association study of proneness to anger.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18951879 2008 Identification of the interaction sites of Inhibitor-3 for protein phosphatase-1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18450750 2008 Protein phosphatase-1 inhibitor-3 is an in vivo target of caspase-3 and participates in the apoptotic response.
17630778 2007 A complex of catalytically inactive protein phosphatase-1 sandwiched between Sds22 and inhibitor-3.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9843442 1998 Identification and characterization of the human HCG V gene product as a novel inhibitor of protein phosphatase-1.
9110174 1997 Large-scale concatenation cDNA sequencing.
8938444 1996 Systematic sequencing of the human HLA-A/HLA-F region: establishment of a cosmid contig and identification of a new gene cluster within 37 kb of sequence.
8781118 1996 Cloning of a human homologue of the mouse Tctex-5 gene within the MHC class I region.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8490624 1993 Localization of seven new genes around the HLA-A locus.
7782091 1995 Localization of new genes and markers to the distal part of the human major histocompatibility complex (MHC) region and comparison with the mouse: new insights into the evolution of mammalian genomes.