Property Summary

NCBI Gene PubMed Count 66
PubMed Score 32.43
PubTator Score 27.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3098 2.7e-20
lung adenocarcinoma 2714 2.3e-14
tuberculosis 1563 1.1e-06
hereditary spastic paraplegia 313 3.2e-04
pediatric high grade glioma 2712 8.1e-04
colon cancer 1475 1.2e-03
psoriasis 6685 1.9e-03
spina bifida 1064 4.6e-02
Disease Target Count Z-score Confidence
Noonan Syndrome 33 3.429 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 1.9e-03
hereditary spastic paraplegia -1.300 3.2e-04
tuberculosis -1.400 1.1e-06
colon cancer -1.300 1.2e-03
pediatric high grade glioma 1.300 8.1e-04
lung adenocarcinoma -1.900 2.3e-14
spina bifida -1.420 4.6e-02
Breast cancer -1.700 2.7e-20

 IMPC Phenotype (1)

 MGI Phenotype (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
463226 confirmatory 1 / 0 / 2 Late stage assay provider results from the probe development effort to identify inhibitors of PP5: radiolabel-based biochemical counterscreen assay to determine activity of inhibitors on dephosphorylation of phosphohistone by PP1

Gene RIF (30)

PMID Text
26334248 These results suggest a unique functional role for the PP1beta isoform in affecting cardiac contractile function
25967976 Findings show that PP1cbeta plays a role in endothelial cell migration through a mechanism involving the interplay of actin cytoskeleton proteins and focal adhesion molecules signaling.
25849655 In the title.
25496916 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25073485 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23382248 results indicate that SCN-iPS cells provide a useful disease model for SCN, and the activation of the Wnt3a/beta-catenin pathway may offer a novel therapy for SCN with ELANE mutation
23197154 PPP1C isoforms have distinct contribution to the outside-in alphaIIbbeta3 signalling-dependent functions in HEK293 alphaIIbbeta3 cells.
23168335 Interaction between protein phosphatase 1 beta and myosin phosphatase (MYPT)1 results in exclusion of Nkx2.5 from the cell nucleus.
22768081 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
22728334 These findings provide evidence for the involvement of a particular PP1 complex, PPP1R12A/PP1cdelta, in insulin signaling.
22360570 Studies indicate that the diversity of the PP1 interactome and the properties of the PP1 binding code account for the exquisite specificity of PP1 in vivo.
22299668 Studies indicate that the Ser/Thr phosphatases PP1 and PP2A are responsible for the dephosphorylation and activation of Rb proteins.
22284538 Studies suggest that any change in substrate specificity of the spinophilin : PP1 holoenzyme complex was probably due to direct modification of a PP1 substrate binding surface.
21795688 Protein phosphatase 1beta (PP1beta) is identified as a phosphatase for the cluster of phosphorylated threonines ((353)TTETQRT(359)) within the sst(2A) somatostatin receptor carboxyl terminus that mediates beta-arrestin binding using siRNA knock-down screening.
21566537 PPP1CB is over expressed in malignant melanoma.
21466834 Data suggest that double-thiophosphorylation of TIMAP has minor effect on its binding ability to PP1c, but considerably attenuates its inhibitory effect on the activity of PP1c.
21360054 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21351466 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
20962268 serine/threonine protein phosphatase PP1beta is a physiological Nucleophosmin (NPM) phosphatase under both the genotoxic stress and growth conditions.
20516061 mammalian Wdr82 functions in a variety of cellular processes; PTW/PP1 phosphatase complex (PNUTS, Tox4, Wdr82, PP1) has a role in the regulation of chromatin structure during the transition from mitosis into interphase
20186153 PP-1 ( PP-1alpha or PP-1beta ) acts as a major phosphatase to dephosphorylate AKT1 at Thr-450 and thus modulate its functions in regulating gene expression, cell survival and differentiation.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18202305 R16A at the membrane may mediate the PB signal to initiate CAR nuclear translocation, through a mechanism including its dimerization and inhibition of PP1beta activity.
17266553 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
16256067 In this study, we show that protein phosphatase-1 (PP1) inhibitor-3 (Inh3) is localized to the nucleoli and centrosomes in interphase HEK 293 cells.
16131488 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
16048649 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
12788939 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
12775419 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
12036313 Protein phosphatase 1, catalytic subunit, beta isoform (PPP1CB) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTD      1 - 70
LLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECK     71 - 140
RRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDK    141 - 210
DVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGG    211 - 280
MMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR                           281 - 327
//

Text Mined References (80)

PMID Year Title
27264673 2016 A novel rasopathy caused by recurrent de novo missense mutations in PPP1CB closely resembles Noonan syndrome with loose anagen hair.
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26334248 2015 Cardiac-specific deletion of protein phosphatase 1? promotes increased myofilament protein phosphorylation and contractile alterations.
25967976 2015 Protein Phosphatase 1 Beta is Modulated by Chronic Hypoxia and Involved in the Angiogenic Endothelial Cell Migration.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849655 2015 The neuronal-specific SGK1.1 (SGK1_v2) kinase as a transcriptional modulator of BAG4, Brox, and PPP1CB genes expression.
25416956 2014 A proteome-scale map of the human interactome network.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23396208 2013 Phosphorylation of FOXP3 controls regulatory T cell function and is inhibited by TNF-? in rheumatoid arthritis.
23382248 2013 Recurrent reciprocal RNA chimera involving YPEL5 and PPP1CB in chronic lymphocytic leukemia.
23197154 2013 Distinct roles for the ? , ? and ?1 isoforms of protein phosphatase 1 in the outside-in ?IIb?3 integrin signalling-dependent functions.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23168335 2013 Myosin phosphatase modulates the cardiac cell fate by regulating the subcellular localization of Nkx2.5 in a Wnt/Rho-associated protein kinase-dependent pathway.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22728334 2012 Protein phosphatase 1 regulatory subunit 12A and catalytic subunit ?, new members in the phosphatidylinositide 3 kinase insulin-signaling pathway.
22360570 2013 The PP1 binding code: a molecular-lego strategy that governs specificity.
22299668 2013 PP1 and PP2A phosphatases--cooperating partners in modulating retinoblastoma protein activation.
22284538 2013 Structural basis for protein phosphatase 1 regulation and specificity.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21998301 2011 Inhibitory member of the apoptosis-stimulating proteins of the p53 family (iASPP) interacts with protein phosphatase 1 via a noncanonical binding motif.
21795688 2011 Rapid dephosphorylation of G protein-coupled receptors by protein phosphatase 1? is required for termination of ?-arrestin-dependent signaling.
21712997 2011 Protein phosphatase 1 (PP1) is a post-translational regulator of the mammalian circadian clock.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21566537 2011 Differential expression patterns of capping protein, protein phosphatase 1, and casein kinase 1 may serve as diagnostic markers for malignant melanoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21466834 2011 Characterization of the effect of TIMAP phosphorylation on its interaction with protein phosphatase 1.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20962268 2010 Dephosphorylation of nucleophosmin by PP1? facilitates pRB binding and consequent E2F1-dependent DNA repair.
20516061 2010 Identification and characterization of a novel human PP1 phosphatase complex.
20424263 2010 SUMOylation of the transcriptional co-repressor KAP1 is regulated by the serine and threonine phosphatase PP1.
20354225 2010 New roles for the LKB1-NUAK pathway in controlling myosin phosphatase complexes and cell adhesion.
20186153 2010 Protein phosphatase-1 regulates Akt1 signal transduction pathway to control gene expression, cell survival and differentiation.
19377461 2009 GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18586956 2008 TIMAP is a positive regulator of pulmonary endothelial barrier function.
18202305 2008 PPP1R16A, the membrane subunit of protein phosphatase 1beta, signals nuclear translocation of the nuclear receptor constitutive active/androstane receptor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17511879 2007 The interaction of PP1 with BRCA1 and analysis of their expression in breast tumors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17274640 2007 A limited screen for protein interactions reveals new roles for protein phosphatase 1 in cell cycle control and apoptosis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16381901 2006 The LIFEdb database in 2006.
16341674 2005 Transcriptome analysis of human gastric cancer.
16256067 2005 Protein phosphatase-1 inhibitor-3 is co-localized to the nucleoli and centrosomes with PP1gamma1 and PP1alpha, respectively.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15705855 2005 A selective inhibitor of eIF2alpha dephosphorylation protects cells from ER stress.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15164081 2004 Structural basis of protein phosphatase 1 regulation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14640981 2004 SIPP1, a novel pre-mRNA splicing factor and interactor of protein phosphatase-1.
12788939 2003 Nuclear protein phosphatase-1 regulates HIV-1 transcription.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226088 2002 Binding of the concave surface of the Sds22 superhelix to the alpha 4/alpha 5/alpha 6-triangle of protein phosphatase-1.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11739654 2001 Dynamic targeting of protein phosphatase 1 within the nuclei of living mammalian cells.
11564868 2001 Growth arrest and DNA damage-inducible protein GADD34 assembles a novel signaling complex containing protein phosphatase 1 and inhibitor 1.
11513739 2001 Cell-cycle-dependent association of protein phosphatase 1 and focal adhesion kinase.
11399775 2001 Phosphorylation of a novel myosin binding subunit of protein phosphatase 1 reveals a conserved mechanism in the regulation of actin cytoskeleton.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11067852 2001 Identification, characterization, and functional analysis of heart-specific myosin light chain phosphatase small subunit.
10906760 2000 Characterization of the protein phosphatase 1 catalytic subunit in endothelium: involvement in contractile responses.
9570949 1998 A new isoform of human myosin phosphatase targeting/regulatory subunit (MYPT2): cDNA cloning, tissue expression, and chromosomal mapping.
9009195 1997 HOX11 interacts with protein phosphatases PP2A and PP1 and disrupts a G2/M cell-cycle checkpoint.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8312365 1994 Three genes for protein phosphatase 1 map to different human chromosomes: sequence, expression and gene localisation of protein serine/threonine phosphatase 1 beta (PPP1CB).
7857673 1994 Chromosomal localization of human, rat, and mouse protein phosphatase type 1 beta catalytic subunit genes (PPP1CB) by fluorescence in situ hybridization.
7796987 1995 Molecular and linkage analysis of type-1 protein phosphatase catalytic beta-subunit gene: lack of evidence for its major role in insulin resistance in Pima Indians.