Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.66
PubTator Score 7.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
glioblastoma -3.100 2.1e-04
osteosarcoma -1.033 1.9e-02
ependymoma -2.000 9.9e-08
periodontitis -1.200 1.5e-20
atypical teratoid / rhabdoid tumor -3.300 2.7e-04
medulloblastoma -1.200 2.2e-04
medulloblastoma, large-cell -2.500 3.3e-06
primitive neuroectodermal tumor -1.500 1.6e-03
fascioscapulohumeral muscular dystrophy 1.059 2.6e-03
Amyotrophic Lateral Sclerosis 1.313 3.0e-04
acute quadriplegic myopathy 1.651 1.1e-03
tuberculosis and treatment for 3 months 2.500 1.9e-06
intraductal papillary-mucinous adenoma (... 1.900 8.6e-03
intraductal papillary-mucinous carcinoma... 1.400 3.6e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.1e-02
diabetes mellitus -1.200 5.4e-03
interstitial cystitis -1.300 1.0e-02
cystic fibrosis -1.900 5.3e-04
pediatric high grade glioma -2.500 3.3e-05
pilocytic astrocytoma -1.700 3.0e-06
lung carcinoma 2.500 1.6e-38
spina bifida -1.139 5.0e-02
Pick disease -1.400 8.0e-03
progressive supranuclear palsy -1.200 4.6e-02
Breast cancer -1.800 4.5e-08
ductal carcinoma in situ -1.200 3.3e-02
invasive ductal carcinoma -2.200 2.8e-03
ovarian cancer -1.100 3.9e-03

Protein-protein Interaction (2)

Gene RIF (6)

PMID Text
22796112 identified ACBD3 as an interacting partner of PPM1L, and showed that this association, which recruits PPM1L to ER-Golgi membrane contact sites, is mediated by a GOLD (Golgi dynamics) domain in ACBD3
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19847890 Genetic variation at chromosome 3 harbors an element that regulates expression of an upstream candidate tumor suppressor, PPM1L, thus providing a novel mechanism for colorectal tumorigenesis.
18165232 CERT is a physiological substrate of PP2Cepsilon and that dephosphorylation of CERT by PP2Cepsilon may play an important role in the regulation of ceramide trafficking from the ER to the Golgi apparatus.
17456047 These results suggest that PP2Cepsilon maintains ASK1 in an inactive state by dephosphorylation in quiescent cells, supporting the possibility that PP2Cepsilon and PP5 play different roles in H2O2-induced regulation of ASK1 activity.
15560375 cloning and characterization of a novel human protein phosphatase 2C cDNA (PP2C epsilon*)

AA Sequence

MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND      1 - 70
RLGGLDVLEAEFSKTWEFKNHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK     71 - 140
SRLPEALKQHLQDYEKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV    141 - 210
GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP    211 - 280
DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK    281 - 350
FRNSSKTEEQ                                                                351 - 360
//

Text Mined References (16)

PMID Year Title
25676576 2015 Adiposity Alters Genes Important in Inflammation and Cell Cycle Division in Human Cumulus Granulosa Cell.
24583629 2014 Genome-wide analysis of methotrexate pharmacogenomics in rheumatoid arthritis shows multiple novel risk variants and leads for TYMS regulation.
24327956 2013 PPM1l encodes an inositol requiring-protein 1 (IRE1) specific phosphatase that regulates the functional outcome of the ER stress response.
24219008 2013 Dynamically regulated miRNA-mRNA networks revealed by exercise.
22796112 2012 Acyl-CoA binding domain containing 3 (ACBD3) recruits the protein phosphatase PPM1L to ER-Golgi membrane contact sites.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19847890 2010 Genome-wide scan identifies a copy number variable region at 3q26 that regulates PPM1L in APC mutation-negative familial colorectal cancer patients.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18165232 2008 Protein phosphatase 2Cepsilon is an endoplasmic reticulum integral membrane protein that dephosphorylates the ceramide transport protein CERT to enhance its association with organelle membranes.
17456047 2007 Regulation of apoptosis signal-regulating kinase 1 by protein phosphatase 2Cepsilon.
16895911 2006 Efficient trafficking of ceramide from the endoplasmic reticulum to the Golgi apparatus requires a VAMP-associated protein-interacting FFAT motif of CERT.
15560375 2004 Molecular cloning and characterization of a novel human protein phosphatase 2C cDNA (PP2C epsilon*).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12556533 2003 Regulation of the interleukin-1-induced signaling pathways by a novel member of the protein phosphatase 2C family (PP2Cepsilon).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.