Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.36
PubTator Score 10.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
ependymoma -1.500 2.8e-02
oligodendroglioma -1.100 4.2e-02
osteosarcoma -1.397 7.8e-04
glioblastoma -2.500 7.1e-06
medulloblastoma -2.700 1.0e-08
atypical teratoid / rhabdoid tumor -3.600 1.8e-06
medulloblastoma, large-cell -4.000 2.3e-06
primitive neuroectodermal tumor -1.500 3.4e-02
juvenile dermatomyositis 2.367 1.1e-14
intraductal papillary-mucinous carcinoma... -1.600 1.3e-03
intraductal papillary-mucinous neoplasm ... -1.500 4.5e-03
active Crohn's disease 1.553 1.4e-03
pediatric high grade glioma -1.800 1.6e-07
lung adenocarcinoma -1.500 3.1e-10
Breast cancer -1.500 2.0e-04
ulcerative colitis 2.600 1.8e-06
ovarian cancer -4.200 2.1e-13
pituitary cancer -1.800 3.5e-05

Gene RIF (8)

PMID Text
26592513 miR-204 and miR-211 directly repress PPM1K expression via 3'UTR.
23446828 Overweight people with the C allele of the branched-chain amino acid/aromatic amino acid ratio-associated variant rs1440581 may benefit less in weight loss and improved insulin sensitivity than those without it on a energy-restricted high-fat diet.
22291014 The 2.4 A PP2Cm structure reveals a central beta-sandwich with two bound metal ions in the active-site cleft.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of protein phosphatase, Mg2+/Mn2+ dependent, 1K (PPM1K) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17336929 The cloned phosphatase has a mitochondrial leader sequence and its amino acid sequence places it in the PP2C family like two known mitochondrial phosphatases.
16685424 A novel member of human protein phosphatase 2C gene family named PP2Ckappa was isolated from a human fetal brain cDNA library.

AA Sequence

MSTAALITLVRSGGNQVRRRVLLSSRLLQDDRRVTPTCHSSTSEPRCSRFDPDGSGSPATWDNFGIWDNR      1 - 70
IDEPILLPPSIKYGKPIPKISLENVGCASQIGKRKENEDRFDFAQLTDEVLYFAVYDGHGGPAAADFCHT     71 - 140
HMEKCIMDLLPKEKNLETLLTLAFLEIDKAFSSHARLSADATLLTSGTTATVALLRDGIELVVASVGDSR    141 - 210
AILCRKGKPMKLTIDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSIGDLDLKTSGVIAEPET    211 - 280
KRIKLHHADDSFLVLTTDGINFMVNSQEICDFVNQCHDPNEAAHAVTEQAIQYGTEDNSTAVVVPFGAWG    281 - 350
KYKNSEINFSFSRSFASSGRWA                                                    351 - 372
//

Text Mined References (25)

PMID Year Title
26592513 2015 Regulation of PP2Cm expression by miRNA-204/211 and miRNA-22 in mouse and human cells.
25416956 2014 A proteome-scale map of the human interactome network.
25288136 2015 Genome-wide meta-analysis identifies six novel loci associated with habitual coffee consumption.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23446828 2013 Genetic determinant for amino acid metabolites and changes in body weight and insulin resistance in response to weight-loss diets: the Preventing Overweight Using Novel Dietary Strategies (POUNDS LOST) trial.
23200863 2012 Mutations in ANO3 cause dominant craniocervical dystonia: ion channel implicated in pathogenesis.
23086801 2013 A novel regulatory defect in the branched-chain ?-keto acid dehydrogenase complex due to a mutation in the PPM1K gene causes a mild variant phenotype of maple syrup urine disease.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22291014 2012 Structural and biochemical characterization of human mitochondrial branched-chain ?-ketoacid dehydrogenase phosphatase.
22286219 2012 Genome-wide association study identifies multiple loci influencing human serum metabolite levels.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18846501 2008 Does parental expressed emotion moderate genetic effects in ADHD? An exploration using a genome wide association scan.
18058037 2007 Structural genomics of protein phosphatases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17374715 2007 A novel mitochondrial matrix serine/threonine protein phosphatase regulates the mitochondria permeability transition pore and is essential for cellular survival and development.
17336929 2007 Identification of a novel PP2C-type mitochondrial phosphatase.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16685424 2006 Characterization of a novel human protein phosphatase 2C family member, PP2Ckappa.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.